<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31508
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFHPQTPQSPSHFSPSSSDQSTSMSGSIVSTTTTLPTPAHSVNGSSLANDMSFTDIVMGENSPQKRKRTSDDVGDREQKKVHIEDRKLGIDDLHLDVGEKYLLCRSQHQPPRPHLSEDLFEMYGLADLAAEYARIKDGQKNALRKTYKGHIKKLGVQGHFDSVKTDEKDPERLEYLMGCPQEEWNAHFVRGKEITRGLSSDMKSKISRAVTMSRGAVPSTLWNNSVLGDIAASSMKAHLNQPPSARPTAPNTPLAYGGPAMQRVKPQTPGFQDNRPRRNIKKRGYGDSSFEGYGEGFEDDGGLETGYSTGEGDMASGLKRRKKAQPGTQSYAQARQQSSYGHHGVSGI |
| Length | 349 |
| Position | Head |
| Organism | Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Sordariaceae> Neurospora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.899 |
| Instability index | 55.01 |
| Isoelectric point | 8.98 |
| Molecular weight | 38321.18 |
| Publications | PubMed=12655011
PubMed=12712197
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31508
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 108.20| 23| 25| 266| 288| 1
---------------------------------------------------------------------------
242- 262 (29.93/12.85) ..QPPSARPTAPNTPLAYGGPAM
266- 288 (40.95/19.92) KPQTPGFQDNRPRRNIKKRGYGD
292- 314 (37.32/17.59) EGYGEGFEDDGGLETGYSTGEGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.32| 27| 30| 133| 161| 3
---------------------------------------------------------------------------
135- 161 (45.83/33.10) RIKDGQKNALRKTYKGHIKKLGVQGHF
163- 189 (49.49/28.93) SVKTDEKDPERLEYLMGCPQEEWNAHF
---------------------------------------------------------------------------
|