<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31505
| Description |
Isoform 2 of Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 194 |
| Position | Head |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.015 |
| Instability index | 64.33 |
| Isoelectric point | 9.83 |
| Molecular weight | 26272.74 |
| Publications | PubMed=15489334
PubMed=12584197
PubMed=15175163
PubMed=17081983
PubMed=18669648
PubMed=19413330
PubMed=19369195
PubMed=20068231
PubMed=23186163
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31505
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 58.38| 12| 19| 199| 210| 2
---------------------------------------------------------------------------
177- 191 (16.52/ 6.91) HKHKQSRTQDpvpPE
199- 210 (21.10/10.66) KKKKKKKEED...PD
218- 228 (20.77/10.39) KKKKKNRH.S...PD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 84.05| 18| 115| 113| 130| 3
---------------------------------------------------------------------------
68- 83 (22.81/11.40) ..MRELPGSTELTGSTNL
113- 130 (34.83/21.06) PGMIDLPGSHDNSSLRSL
230- 243 (26.41/14.30) PGM....GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.75| 15| 19| 29| 44| 4
---------------------------------------------------------------------------
29- 43 (33.13/ 7.18) PP....PPPPPAGGGPGTA
45- 63 (24.63/ 6.77) PPtaatAPPGADKSGAGCG
---------------------------------------------------------------------------
|
Associated diseases