| Description | Isoform 2 of Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 194 |
| Position | Head |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.015 |
| Instability index | 64.33 |
| Isoelectric point | 9.83 |
| Molecular weight | 26272.74 |
| Publications | PubMed=15489334 PubMed=12584197 PubMed=15175163 PubMed=17081983 PubMed=18669648 PubMed=19413330 PubMed=19369195 PubMed=20068231 PubMed=23186163 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
| Binary Interactions | [A0JLT2<-->Q9NX70: MED29] NbExp=8 EBI-394430,EBI-394656 [A0JLT2-2<-->Q86UW9: DTX2] NbExp=3 EBI-13288755,EBI-740376 [A0JLT2-2<-->P62993: GRB2] NbExp=3 EBI-13288755,EBI-401755 [A0JLT2-2<-->P50747: HLCS] NbExp=3 EBI-13288755,EBI-3915568 [A0JLT2-2<-->Q63ZY3: KANK2] NbExp=3 EBI-13288755,EBI-2556193 [A0JLT2-2<-->Q92993: KAT5] NbExp=3 EBI-13288755,EBI-399080 [A0JLT2-2<-->Q8TAP4-4: LMO3] NbExp=3 EBI-13288755,EBI-11742507 [A0JLT2-2<-->Q14511-2: NEDD9] NbExp=3 EBI-13288755,EBI-11746523 [A0JLT2-2<-->P17252: PRKCA] NbExp=3 EBI-13288755,EBI-1383528 [A0JLT2-2<-->Q0D2K3: RIPPLY1] NbExp=3 EBI-13288755,EBI-10226430 [A0JLT2-2<-->Q15047-2: SETDB1] NbExp=3 EBI-13288755,EBI-9090795 [A0JLT2-2<-->Q13148: TARDBP] NbExp=3 EBI-13288755,EBI-372899 [A0JLT2-2<-->P61981: YWHAG] NbExp=3 EBI-13288755,EBI-359832 [A0JLT2-2<-->P36508: ZNF76] NbExp=3 EBI-13288755,EBI-7254550 |
| Repeats |
>MDP31505
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 58.38| 12| 19| 199| 210| 2
---------------------------------------------------------------------------
177- 191 (16.52/ 6.91) HKHKQSRTQDpvpPE
199- 210 (21.10/10.66) KKKKKKKEED...PD
218- 228 (20.77/10.39) KKKKKNRH.S...PD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 84.05| 18| 115| 113| 130| 3
---------------------------------------------------------------------------
68- 83 (22.81/11.40) ..MRELPGSTELTGSTNL
113- 130 (34.83/21.06) PGMIDLPGSHDNSSLRSL
230- 243 (26.41/14.30) PGM....GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.75| 15| 19| 29| 44| 4
---------------------------------------------------------------------------
29- 43 (33.13/ 7.18) PP....PPPPPAGGGPGTA
45- 63 (24.63/ 6.77) PPtaatAPPGADKSGAGCG
---------------------------------------------------------------------------
|
| Disease | prostate cancer PMID:31715665 PMID:28125713 tongue cancer PMID:23705783 breast cancer PMID:30161287 PMID:27572702 PMID:20890603 PMID:30583076 gastric cancer PMID:22565189 lung cancer PMID:25735376 bladder cancer PMID:21478038 PMID:23276457 PMID:28631286 cervical cancer PMID:30473219 bone metastasis PMID:23276457 |
| MoRF Sequence | Start | Stop |
| 1) DSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSP 2) FGPGKP 3) MENFTAL | 195 23 1 | 227 28 7 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab