<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31504
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSCHPQTPQSPSQFSPNTSDLMMSMTGSVTSTTTTLPTPAHSVNGSSIPSELTQDTAMGDDSPHKRKRDGDDMGSRAQKKVHVEDRKLGIDDLHMDVGEKYLLCRTPHPRPRPHVSEDLFEMYGLTGLAIEVARVRPNGEKNALRKTYKGHIKRLGVQGHFDEDKQDPNREYSLSHLMKLPQDVWDLQHVRGQDIRDGFTNEVQQKLSRAMTMGRGVVPRDQWDSSVLGEMGPGKGERQALSARPTAPNTPLPSAGPQGLPRPKTGTPLMQDASRSMRTIKKRSYGDSSFEGYGESYDDGADTGYSTGEGDMSSGQKRRKKVLIND |
| Length | 326 |
| Position | Head |
| Organism | Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Chaetomium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.959 |
| Instability index | 48.87 |
| Isoelectric point | 8.40 |
| Molecular weight | 36015.86 |
| Publications | PubMed=25720678
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31504
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.47| 13| 23| 191| 207| 2
---------------------------------------------------------------------------
191- 203 (23.66/19.12) RGQDIRDGFTNEV
215- 227 (24.81/ 9.63) RGVVPRDQWDSSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.15| 12| 16| 239| 252| 3
---------------------------------------------------------------------------
239- 252 (13.71/15.61) QALsARPTApNTPL
258- 269 (24.44/13.63) QGL.PRPKT.GTPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.09| 21| 98| 3| 27| 4
---------------------------------------------------------------------------
3- 27 (30.03/28.71) ChpQTPQsPSQfSPNTS.DL..MMSMTG
104- 127 (36.06/17.57) C..RTPH.PRP.RPHVSeDLfeMYGLTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.52| 17| 27| 54| 76| 5
---------------------------------------------------------------------------
46- 74 (19.61/16.97) SS.ipseltQDTAMGDDSPHKrkrdgdDMG
75- 98 (23.91/ 8.66) SRaqkkvhvEDRKLGIDDLHM......DVG
---------------------------------------------------------------------------
|