Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MNEPSACSGPPVKSKSSKNEPFYTLKALLPPYSEIQGNHDLLMSYELGPVEGGFSGSRRVKEKISSFLPHIIGEFHLDATKEASSLRALIEKPPIHKEISNLTSSSMQGFKLSAGPVDERYRHLFERRKEEPNLAYSEKLNLIRVRQQYDAYGFDDDETEKGFPKKHKKKKKDKKRKKEKEELGDAEKRKRAADEPMEF |
Length | 199 |
Position | Head |
Organism | Caenorhabditis elegans |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.08 |
Grand average of hydropathy | -1.038 |
Instability index | 59.26 |
Isoelectric point | 9.17 |
Molecular weight | 22797.63 |
Publications | PubMed=9851916 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
GO - Biological Process | multicellular organism development GO:0007275 IEA:UniProtKB-KW positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31502 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.18| 14| 47| 126| 139| 1 --------------------------------------------------------------------------- 126- 139 (24.28/10.96) ERRKEEPNLAYSEK 175- 188 (22.90/10.04) KRKKEKEELGDAEK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKGFPKKHKKKKKDKKRKKEKEELGDA 2) SKNEPFYTLKALLPPY | 160 17 | 186 32 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab