| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MNEPSACSGPPVKSKSSKNEPFYTLKALLPPYSEIQGNHDLLMSYELGPVEGGFSGSRRVKEKISSFLPHIIGEFHLDATKEASSLRALIEKPPIHKEISNLTSSSMQGFKLSAGPVDERYRHLFERRKEEPNLAYSEKLNLIRVRQQYDAYGFDDDETEKGFPKKHKKKKKDKKRKKEKEELGDAEKRKRAADEPMEF |
| Length | 199 |
| Position | Head |
| Organism | Caenorhabditis elegans |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -1.038 |
| Instability index | 59.26 |
| Isoelectric point | 9.17 |
| Molecular weight | 22797.63 |
| Publications | PubMed=9851916 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
| GO - Biological Process | multicellular organism development GO:0007275 IEA:UniProtKB-KW positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP31502
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.18| 14| 47| 126| 139| 1
---------------------------------------------------------------------------
126- 139 (24.28/10.96) ERRKEEPNLAYSEK
175- 188 (22.90/10.04) KRKKEKEELGDAEK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EKGFPKKHKKKKKDKKRKKEKEELGDA 2) SKNEPFYTLKALLPPY | 160 17 | 186 32 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab