Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MFNNYGNVMMTDQFRKVEQYSPKSSPRAGGAGGRSPVVARQDSSGTLKTTIQLGKNPSIVHSGPFYLMKEPPGEGELTGATNLMAHYGLEHSYSKFSGKKVKEQLSSFLPNLPGVIDGPGHLDNSSLRSVIEKPPIGGKDLLPLTSVQLAGFRLHPGPLPEQYKHLKSVPTRKHKNKHKKHKYKEGVAPLSEQSALEASGLDTHEKKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHPGSGAASMPPQTQVF |
Length | 253 |
Position | Head |
Organism | Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Aedini> Aedes> Stegomyia. |
Aromaticity | 0.06 |
Grand average of hydropathy | -1.036 |
Instability index | 54.00 |
Isoelectric point | 10.02 |
Molecular weight | 28086.74 |
Publications | PubMed=17510324 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31500 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 102.67| 22| 43| 161| 182| 1 --------------------------------------------------------------------------- 161- 182 (39.85/19.06) EQYKHLKSVPTRKHKNKHKKHK 192- 209 (29.10/12.32) EQ.SALEASGLDTHE...KKHK 210- 230 (33.73/15.22) KQKRH.EDDKERKKRKKEKKRK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HKKHKYK 2) KKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHP | 178 206 | 184 239 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab