<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31495
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MVHQLSLVSSIAHGSYVQTVSTLQAFTGMLSPQPIATYTLLTKPHEVFKPKFEPGKVNQIEQYYMKCITTWSDGSEFDLASAVIKENGSSNVFSGRLFHAEDESVQRIWTLQISDIPIAGKNQACSAQTIYESTLIHTHTNVKSEENKIDAMDVDLEHKDKSDVKGDTKEKEEDKKEEDKKEEDKKEEDKKEEDKKEEDKKEEEKVEKKNDEVKHSEVNLEDGAETGSGHKDSFLQFLEDLGYETISQYWIKGIRFFHGDIVIEIFKVLVRDDEVTEPKEEGKIALKLLDESNTFQIRTYINIAKSTDIDLINQGTKELLRLQEFLKNLFKLEIPDRMFMDSRVQVRK |
Length | 348 |
Position | Head |
Organism | Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Scheffersomyces.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.760 |
Instability index | 34.32 |
Isoelectric point | 5.01 |
Molecular weight | 40075.53 |
Publications | PubMed=17334359
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP31495
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.63| 19| 19| 169| 187| 1
---------------------------------------------------------------------------
169- 187 (34.50/16.59) KEKEEDKKEEDKKEEDKKE
189- 207 (33.13/15.67) DKKEEDKKEEDKKEEEKVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.26| 20| 85| 12| 36| 2
---------------------------------------------------------------------------
12- 36 (30.67/38.40) AHGSYVQTVSTLQaftgmLSPQPIA
100- 119 (36.59/28.59) AEDESVQRIWTLQ.....ISDIPIA
---------------------------------------------------------------------------
|