<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31490
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHELLLFASVPSHQHHELLQQLTGLTAMQPRHCLERRLIFKATRKPDLANMRSGTGQGPDIVRLNKMLNGQMFYTQVVGPLSEADFDGKPSSSDSQDVSMSGTHEAAGSSYDYDSQPWRLEFRDTPEAGFRSTITARLAASAALPKGDVVPSMNAWGYSFVTEYVVEGDMFIYNDIVIFLHRVLQYPATGQEPHEPRRQLPSFRDLAPLEKTGSYILQAAITVQDGSNQELMRTASQHLFGLREQLKSAVRLEHADRLSLDTRAR |
| Length | 265 |
| Position | Head |
| Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.435 |
| Instability index | 44.51 |
| Isoelectric point | 6.20 |
| Molecular weight | 29716.19 |
| Publications | PubMed=16372000
PubMed=19146970
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31490
No repeats found
|