<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31482
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MDNVVDVDEEGNQQKLSANSTPYQTQECVLYGSIFVKNVPDLERRLAGLWIRAAKNSMSTKCRSALEPPVHQILRRRFRTEHQIQNYWQLKYIGVPEPDQKCPTIVRKEISSLVHSQDMMTYAKSLGLRMDYEYITQGKLWTKGNIKILHSTLTRTLRAGTYDSSSLKSMSDSALVEISISLPESAEYMPAAKSLRDFADQLMPLVNMEKIDYWKKMFSTPAAPARR |
Length | 227 |
Position | Head |
Organism | Caenorhabditis briggsae |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.496 |
Instability index | 58.53 |
Isoelectric point | 9.15 |
Molecular weight | 26011.62 |
Publications | PubMed=14624247
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31482
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.75| 18| 66| 109| 126| 1
---------------------------------------------------------------------------
109- 126 (33.07/18.70) EIS.SLVHSQDMMTYAKSL
177- 195 (27.68/14.77) EISiSLPESAEYMPAAKSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 102.26| 33| 109| 27| 59| 2
---------------------------------------------------------------------------
27- 59 (59.01/35.19) ECVLYGSIFVK.NV....PDLERRL.AGLWIRAAKNSMS
133- 171 (43.25/24.35) EYITQGKLWTKgNIkilhSTLTRTLrAGTYDSSSLKSMS
---------------------------------------------------------------------------
|