<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31481
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MEAPPVTMMPVTGGTINMMEYLLQGSVLDHSLESLIHRLRGLCDNMEPETFVDHEMVFLLKGQQASPFVLRARRSLDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVARGHLFRKGIMKIVVYKIFRILVPGNTDNTEALSLSYLVELSVVAPAGQDMVSDDMRNFAEQLKPLVHLEKIDPKRLM |
Length | 208 |
Position | Head |
Organism | Bos taurus (Bovine) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Bovinae> Bos.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.114 |
Instability index | 35.83 |
Isoelectric point | 6.06 |
Molecular weight | 23681.37 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31481
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.82| 24| 94| 17| 40| 2
---------------------------------------------------------------------------
17- 40 (39.05/24.34) NMMEYLLQ.GSVLDHSLESLIHRL......R
85- 112 (24.78/13.14) ..LRYLGQ.PEMGDKNRHALVRNCvdiatsE
113- 137 (35.99/21.94) NLTDFLMEmGFRMDHEFVARGHLF......R
---------------------------------------------------------------------------
|