<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31458

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMTQLTENTDELHSIRLAIDPNLITLPIGSKSTSPHSNSTSDGNPESHNTENEEVDNKAGSLPPEQFSNNSAKLIVNPYEKYGRMSLGQLIPLISQQRGPNFKFADINEDILKQELAIENDNGKQESKDDTKAEDGIDTMDIDQNDNSEANTNDIGYNEWSNEPKEDTGILDNTQDTNINGEMESQLTQEEFNKIRKVMLEHINMAMNESSLAMEFVSLLLSPVRESTAVSSMSPFLKKTVNPGSLNSEKVKMPAVSRRDKLSLSILSRGWKLRALNEARAILKKNFTEISSSLKQEHHYWSSIAYNISNKDVLFKIRDKQTTKRSLGLKYGYEDSGSTFRNDRGTAILRGTDEANGLELIPLTLGRTSTVGSVYKGGKFLRVRIFTKIESEGDYILSGESSLDKLFKNHSENSDSKNDDVRLQISKLKFFIFEQELMHQLKKECAYLISYGVTVENEHKIVIELPNEKFEIEYLSLDDDSVVNHEQDAPKANDRRANLMLVTLRMLLIVIYKKNLRQKMVSNTRKHIASTEKDILLIRPLLGKMRHSNHKKLIRKILKECVLEVVPDTELQERSIQSLDKEDFETFDLQDAHIVKLTKDINAFRNVLDVGKTEFTIDMKQSGKLSLILESPNYCNAQVSIKYDNQTSNTHFNTVSTEFKEVEEFLHFLISTYVNPE
Length676
PositionHead
OrganismCandida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Nakaseomyces> Nakaseomyces/Candida clade.
Aromaticity0.06
Grand average of hydropathy-0.615
Instability index45.87
Isoelectric point5.53
Molecular weight76903.79
Publications
PubMed=15229592

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).
ECO:0000250	
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
activating transcription factor binding	GO:0033613	IEA:EnsemblFungi
RNA polymerase II complex recruiting activity	GO:0001139	IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding	GO:0000979	IEA:EnsemblFungi
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP31458
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.66|      18|      32|     119|     150|       1
---------------------------------------------------------------------------
  119-  136 (31.92/ 8.58)	NDNGKQESKDDTKAEDGI
  152-  169 (33.75/30.83)	NDIGYNEWSNEPKEDTGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.98|      28|      32|     270|     297|       2
---------------------------------------------------------------------------
  220-  249 (26.11/12.94)	..LSPVR.ESTAVssmspfL....KK..TVNPGSLNSEK
  270-  297 (46.84/28.58)	WKLRALN.EARAI......L....KKNFTEISSSLKQEH
  300-  329 (25.03/12.13)	WSSIAYNiSNKDV......LfkirDKQTTKRSLGLK...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.39|      11|      32|     336|     349|       3
---------------------------------------------------------------------------
  336-  349 (14.70/16.72)	GSTFrndRGTAILR
  371-  381 (20.69/12.16)	GSVY...KGGKFLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.48|      13|      23|     178|     191|       4
---------------------------------------------------------------------------
  178-  191 (20.34/20.30)	INGEM.ESQLTQeEF
  202-  215 (20.14/13.67)	INMAMnESSLAM.EF
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31458 with Med17 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) KQELAIENDNGKQESKDDTKAEDGIDTMDIDQNDNSEANTNDIGYNEWSNEPKEDTGILDNTQDTNINGEMESQLT
2) LPIGSKSTSPHSNSTSDGNPESHNTENEEVDNKAGSLPPEQFSNNSAKLI
112
25
187
74

Molecular Recognition Features

MoRF SequenceStartStop
NANANA