<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31438

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMPLIMEDGINVDDLFGESTSLELGLPTSTPTASTKGLAQRLDEMRLVGCCQKIAWSRLGCIASISQDSTRVNVRHLQCQQSDGKWLLSDETPLNQVSEVHAGHALVHLCWNDSGTELAVADSSGRVSIYSIPIALNSVNVTRQAAFDPDDDGAQIVGMMWLSQYRSVHSFYQAAKVQGRWAYSPFRRRPIGTFHPAHKGALLCITRSGVMKLLYQNPDGRWAEITTELKNTSYSDRLLTHAALVTTQAGILVATHSACQRISLYRVSIQWTPSQWDPTQQKQGSQQFPTPSFRLVHMKVEVPYNIPSSNRDAGENPDEQLPFTSSLYCLTSLHIILPASDNSAGSTPNPWIVAVFSIPTHAILPHPQPQIPASVIVRWQLETSLMTLHPRFDDVPSKKGNGQVKPKTVLRRLDDITSGRHVISVDQTEYGNVLAVSYDDSSIAFYDPKTMAAFDGIDDANTVTSLAQAGFHYPLEPSALHMSFSPSACLIVGLDNDGQTHLRIMEHSYGAENGHYDENKYSAAIASLTLAFCRGCGGEVNTDDILLILIRQLSPDAQTAFLNEVYRALSINCNFTTEQDKLMNHPYIPRALSIQAALGFKGKFRARNIASNVPWAIIQLRQAAMIYPSFFQYNKGVQGPEPHDPDVLRLVLGNTKWALDFSLYILNELFDLADDFESVSSDQEAFNQKLKTTTSLPLIILLSSMSRAFLRFICRGLRGIHAGYANAPLTGDSRVYYTEICQTLDASPVRTDVYEKLLAGVDSAVKHAYTGAGFGDNERPGPEKELLVSSRIPPVLVPAVSTILRQTVPAMRGEMDRLAIFMGDYGWLGFGNDARSELYRRERDVDIIKKTPIASRSGKGSGLGSVEAVMGLGARNGNGSQLSRRCVRCCEVSEAMYPPRSVLSFKMTLKLGHLRSCICGGMWNLEGGLPG
Length930
PositionTail
OrganismEmericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes.
Aromaticity0.08
Grand average of hydropathy-0.177
Instability index41.35
Isoelectric point6.50
Molecular weight102377.28
Publications
PubMed=16372000
PubMed=19146970

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
ECO:0000250
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
GO - Biological Process
positive regulation of transcription, DNA-templated	GO:0045893	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31438
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     125.54|      37|      40|     433|     472|       1
---------------------------------------------------------------------------
  405-  431 (29.95/13.87)	................PKTvLRRLDDIT.SGRHVISVDQTEY.....GN
  433-  472 (58.67/44.57)	LAVSYDDSS..IAfydPKT.MAAFDGID.DANTVTSLAQAGF.....HY
  479-  515 (36.93/19.83)	LHMSFSPSAclIV............GLDnDGQTHLRIMEHSYgaengHY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.90|      23|      38|     550|     573|       2
---------------------------------------------------------------------------
  550-  573 (37.11/26.75)	RQLSPDAQTAFLNEvYRALSINCN
  589-  611 (38.79/23.50)	RALSIQAALGFKGK.FRARNIASN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.28|      10|      40|     170|     181|       3
---------------------------------------------------------------------------
  170-  181 (16.81/14.44)	FYQAAkvQGRWA
  213-  222 (22.47/12.51)	LYQNP..DGRWA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     132.96|      32|      32|     286|     317|       5
---------------------------------------------------------------------------
  260-  282 (32.68/23.00)	.........RISLYRVSIQWT.P.SQWDPTQQKQ
  286-  317 (57.71/47.95)	QFPTPS..FRLVHMKVEVPYNIPSSNRDAGENPD
  319-  348 (42.56/32.85)	QLPFTSslYCLTSLHI....ILPASDNSAGSTPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     163.04|      46|     836|      45|      92|       6
---------------------------------------------------------------------------
   45-   92 (75.54/72.27)	RLVGCCQkIAWSRLGCIASISQDSTrVNVRHLQCQQSDGKWLLSDETP
  884-  929 (87.50/71.99)	RCVRCCE.VSEAMYPPRSVLSFKMT.LKLGHLRSCICGGMWNLEGGLP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31438 with Med16 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




NANANA