<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31438

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMPLIMEDGINVDDLFGESTSLELGLPTSTPTASTKGLAQRLDEMRLVGCCQKIAWSRLGCIASISQDSTRVNVRHLQCQQSDGKWLLSDETPLNQVSEVHAGHALVHLCWNDSGTELAVADSSGRVSIYSIPIALNSVNVTRQAAFDPDDDGAQIVGMMWLSQYRSVHSFYQAAKVQGRWAYSPFRRRPIGTFHPAHKGALLCITRSGVMKLLYQNPDGRWAEITTELKNTSYSDRLLTHAALVTTQAGILVATHSACQRISLYRVSIQWTPSQWDPTQQKQGSQQFPTPSFRLVHMKVEVPYNIPSSNRDAGENPDEQLPFTSSLYCLTSLHIILPASDNSAGSTPNPWIVAVFSIPTHAILPHPQPQIPASVIVRWQLETSLMTLHPRFDDVPSKKGNGQVKPKTVLRRLDDITSGRHVISVDQTEYGNVLAVSYDDSSIAFYDPKTMAAFDGIDDANTVTSLAQAGFHYPLEPSALHMSFSPSACLIVGLDNDGQTHLRIMEHSYGAENGHYDENKYSAAIASLTLAFCRGCGGEVNTDDILLILIRQLSPDAQTAFLNEVYRALSINCNFTTEQDKLMNHPYIPRALSIQAALGFKGKFRARNIASNVPWAIIQLRQAAMIYPSFFQYNKGVQGPEPHDPDVLRLVLGNTKWALDFSLYILNELFDLADDFESVSSDQEAFNQKLKTTTSLPLIILLSSMSRAFLRFICRGLRGIHAGYANAPLTGDSRVYYTEICQTLDASPVRTDVYEKLLAGVDSAVKHAYTGAGFGDNERPGPEKELLVSSRIPPVLVPAVSTILRQTVPAMRGEMDRLAIFMGDYGWLGFGNDARSELYRRERDVDIIKKTPIASRSGKGSGLGSVEAVMGLGARNGNGSQLSRRCVRCCEVSEAMYPPRSVLSFKMTLKLGHLRSCICGGMWNLEGGLPG
Length930
PositionTail
OrganismEmericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes.
Aromaticity0.08
Grand average of hydropathy-0.177
Instability index41.35
Isoelectric point6.50
Molecular weight102377.28
Publications
PubMed=16372000
PubMed=19146970

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
GO - Biological Process
positive regulation of transcription, DNA-templated	GO:0045893	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31438
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     125.54|      37|      40|     433|     472|       1
---------------------------------------------------------------------------
  405-  431 (29.95/13.87)	................PKTvLRRLDDIT.SGRHVISVDQTEY.....GN
  433-  472 (58.67/44.57)	LAVSYDDSS..IAfydPKT.MAAFDGID.DANTVTSLAQAGF.....HY
  479-  515 (36.93/19.83)	LHMSFSPSAclIV............GLDnDGQTHLRIMEHSYgaengHY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.90|      23|      38|     550|     573|       2
---------------------------------------------------------------------------
  550-  573 (37.11/26.75)	RQLSPDAQTAFLNEvYRALSINCN
  589-  611 (38.79/23.50)	RALSIQAALGFKGK.FRARNIASN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.28|      10|      40|     170|     181|       3
---------------------------------------------------------------------------
  170-  181 (16.81/14.44)	FYQAAkvQGRWA
  213-  222 (22.47/12.51)	LYQNP..DGRWA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     132.96|      32|      32|     286|     317|       5
---------------------------------------------------------------------------
  260-  282 (32.68/23.00)	.........RISLYRVSIQWT.P.SQWDPTQQKQ
  286-  317 (57.71/47.95)	QFPTPS..FRLVHMKVEVPYNIPSSNRDAGENPD
  319-  348 (42.56/32.85)	QLPFTSslYCLTSLHI....ILPASDNSAGSTPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     163.04|      46|     836|      45|      92|       6
---------------------------------------------------------------------------
   45-   92 (75.54/72.27)	RLVGCCQkIAWSRLGCIASISQDSTrVNVRHLQCQQSDGKWLLSDETP
  884-  929 (87.50/71.99)	RCVRCCE.VSEAMYPPRSVLSFKMT.LKLGHLRSCICGGMWNLEGGLP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31438 with Med16 domain of Kingdom Fungi
Unable to open file!