<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31427

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMDVSGQETDWRSAAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPTPGAAGIGMPPRGPGQSLGGMGGLGAMGQPLPLSGQPPPGTSGMAPHGMAVVSTATPQTQLQLQQVALQQQQQQQQQQQFQQQQAALQQQQQQQQQQQQQQQFQAQQNAMQQQFQAVVQQQQLQQQQQQQHLIKLHHQSQQQQIQQQQLQRMAQLQLQQQQQQQQQQALQAQPPMQQPSMQQPQPPPSQALPQQLSQLHHPQHHQPPPQAQQSPIAQNQPPQIPPQSQSQPLVSQAQALPGPMLYAAQQQLKFVRAPMVVQQPQVQPQVQQVQPQVQPQAAVQAAQSAQMVAPGVQMIAEALAQGGMHVRARFPPTSTMSAGPSSSISLGGQPTTQVSQSSLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVLPTKQQDLCQPLLDAVLANIRSPVFNHSLYRTFVPAMMAIHGPPIVSPVVCSRKRRFEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPMWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSAA
Length789
PositionTail
OrganismMus musculus (Mouse)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Mus> Mus.
Aromaticity0.03
Grand average of hydropathy-0.675
Instability index87.47
Isoelectric point9.39
Molecular weight86606.32
Publications
PubMed=11414760
PubMed=19468303
PubMed=21183079
PubMed=24129315

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for cholesterol- dependent gene regulation. Positively regulates the Nodal signaling pathway (By similarity). 
ECO:0000250
GO - Cellular Component
cytoplasm	GO:0005737	IEA:UniProtKB-SubCell
mediator complex	GO:0016592	IEA:InterPro
nucleoplasm	GO:0005654	TAS:Reactome
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
stem cell population maintenance	GO:0019827	IMMGI

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31427
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     138.06|      32|      33|     161|     192|       1
---------------------------------------------------------------------------
  174-  206 (49.94/ 8.59)	QQQAALQQQQQQQQQQQQQ......QQFQ.....AQQnaMQQQF.
  207-  242 (43.11/ 6.18)	..QAVVQQQQLQQQQQQQHliklhhQSQQ.....QQI..QQQQLQ
  289-  325 (45.01/ 6.85)	QLHHPQHHQPPPQAQQSPI......AQNQppqipPQS..QSQPLV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.21|      20|      22|     439|     460|       3
---------------------------------------------------------------------------
  439-  459 (39.01/11.41)	SPSPgQQVQTPQSMPPPPQPS
  484-  503 (32.20/ 8.32)	SPSP.QPSQSPVTARTPQNFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.87|      17|      19|      86|     102|       4
---------------------------------------------------------------------------
  121-  140 (28.88/ 8.00)	QPLPLSGQPPPGTSGMaphG
  257-  273 (31.99/ 9.83)	QQQALQAQPPMQQPSM...Q
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.08|      18|      21|      81|      98|       6
---------------------------------------------------------------------------
   81-   98 (34.78/20.04)	PMNALQSLTGGPTPGAAG
  103-  120 (36.30/21.28)	PRGPGQSLGGMGGLGAMG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.25|      20|      22|     615|     634|       7
---------------------------------------------------------------------------
  615-  634 (34.52/19.00)	QQDLCQPLLDAVLA....NIRSPV
  636-  659 (29.73/15.16)	NHSLYRTFVPAMMAihgpPIVSPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.62|      29|      34|     534|     564|       8
---------------------------------------------------------------------------
  534-  564 (40.72/41.49)	LDKLKQLSKYIePLRRMiNKID.KNEDRKKDL
  571-  600 (46.90/35.97)	LDILTDPSKRC.PLKTL.QKCEiALEKLKNDM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.68|      11|     100|     504|     516|       9
---------------------------------------------------------------------------
  504-  516 (19.22/10.70)	VPSPGPlnTPVNP
  602-  612 (25.46/ 8.93)	VPTPPP..PPVLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.79|      11|      27|     747|     757|      10
---------------------------------------------------------------------------
  747-  757 (23.12/13.58)	NPFLQSVHR.CM
  775-  786 (18.67/ 9.64)	NTWAQSIHQaCL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31427 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) HNKKSQASVSDPMNALQSLTGGPTPGAAGIGMPPRGPGQSLGGMGGLGAMGQPLPLSGQPPPGTSGMAPHGMAVVSTAT
2) QPQVQPQVQQVQPQVQPQAAVQAAQSAQMVAPGVQMIAEALAQGGMHVRARFPPTSTMSAGPSSSISLGGQPTTQVSQSSLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQ
3) QQQQQALQAQPPMQQPSMQQPQPPPSQALPQQLSQLHHPQHHQPPPQAQQSPIAQNQPPQIPPQSQSQPLVSQAQALPG
70
354
255
148
539
333










Molecular Recognition Features






MoRF SequenceStartStop




NANANA