<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31421

Description Isoform b of Mediator of RNA polymerase II transcription subunit 15
SequenceMSEEDWPSPKFREHVIQRLEPELARNRQNAPNLPVPGDARQVEEYVFAKCMSKDEYMRTIAKVINAINCNSKSAAVPSVLQPSQFHSPPCTTAALLGNTPAGGTPGYRAPVPPDPQPTSAQARNPPVTVATTQASTTPSAPNPPGGLPAPSASATAAVAAAVASFPSPDTSIRPGGQITPGSQAPGGGPTPAPNVPFPNGSSQMNGGPAMGQPPPQMGAPNMGGPPNGYGGYGMMNGPPGSGAPMGGNPYNQQIKKDMDQARPWDPSAHMYQQQPQWGAMPPQQPHGYPGRPMNGQGATPTGPSSVLESLINQPQQYPGHHNQMGPPGDRNVAAQRAAAQQQQQQQQQQQQQRPGMVPNQGMMSSEDQTVYSAKLRNMRGSCDSLRTRARQCRHEGNHEAAHKLEVMLSVLEGKRVVSLEYLNHLEMWIARKQDFLNIAPMSQNQNHMGMNDPMMNGEHAMLGNGQVPNPYGGHPGYGHQQYMGPPPPHMQMHQPPMWHQQQHQQQQRMMPQDHMMMQGGGGPVHGMYRGDMGHDPMTSPVNNHRHAPYPNPAAMRNNMRMPNGPGPIGRDRNSMSGSSMSGPSSGAPSMNPMGTPNQKMGTPGSMGGMSGLDDLNYDDFLPNPTPIDALQPTLHVGQNSMNAGPPVQRSNLNETARKELQILDARFEIDPNHQRHDANHIIVVCKIRNQQFPPLRLVVPTTYPAGNVTVDRAVIDLDAYLYDDLQNSVYERLSRPGLSSITDYLNAWEEQVNQYQNQTSGGLDVAFNVGNDFFYDNLNL
Length777
PositionTail
OrganismCaenorhabditis elegans
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis.
Aromaticity0.05
Grand average of hydropathy-0.804
Instability index55.96
Isoelectric point6.61
Molecular weight84526.70
Publications
PubMed=9851916
PubMed=16651656
PubMed=16799563

Function

Annotated function Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). Required for regulated expression of genes controlling fatty acid desaturation by factors including sbp-1 and nhr-49. 
ECO:0000250	
ECO:0000269	PubMed:16651656
ECO:0000269	PubMed:16799563
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
nucleus	GO:0005634	IBA:GO_Central
GO - Biological Function
nuclear hormone receptor binding	GO:0035257	IPI:WormBase
nucleic acid binding	GO:0003676	IBA:GO_Central
transcription coactivator activity	GO:0003713	IDA:WormBase
GO - Biological Process
determination of adult lifespan	GO:0008340	IMWormBase
embryo development ending in birth or egg hatching	GO:0009792	IMWormBase
locomotion	GO:0040011	IMWormBase
mRNA splicing, via spliceosome	GO:0000398	IBA:GO_Central
nematode larval development	GO:0002119	IMWormBase
positive regulation of transcription, DNA-templated	GO:0045893	IDA:WormBase
regulation of fatty acid metabolic process	GO:0019217	IMWormBase
regulation of gene expression	GO:0010468	IMWormBase
regulation of multicellular organism growth	GO:0040014	IMWormBase
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
sequestering of triglyceride	GO:0030730	IMWormBase

Interaction

Binary Interactions
[Q21955<-->O45666: nhr-49]	NbExp=4	EBI-318240,EBI-318820

Repeat regions

Repeats

>MDP31421
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     207.27|      33|      34|     184|     216|       1
---------------------------------------------------------------------------
  122-  156 (38.90/ 7.00)	ARNPPVTVATTQASTTPSAPNP...PGGlpAPS..ASATA
  192-  224 (52.18/12.14)	APNVPFPNGSSQMNGGPAMGQP...PPQmgAPN..MGG..
  225-  250 (36.54/ 6.09)	....P.PNG....YGGYGMMNG...PPGsgAPM..GGNPY
  451-  481 (42.70/ 8.47)	..NDPMMNGEHAMLGNGQVPNP...YGG..HPG..YGHQQ
  571-  604 (36.94/ 6.24)	DRNSMS..GSSM..SGPSSGAPsmnPMG..TPNqkMGTPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     316.22|      71|     156|     324|     394|       2
---------------------------------------------------------------------------
  251-  339 (88.03/31.45)	..NQQIKKDMDQARPwdpsaHMYqqqPQWGAMPPQQ....PHGYPGRPMNGQGATptgpssvlESL...INQPQQ..........................ypghhnqM......GP..PGDRNVAAQRAAA
  340-  424 (109.20/40.94)	QQQQQQQQQQQQQRP.....GMV...PNQGMMSSED....QTVYSAKLRNMRGSC........DSLRTRARQCRH.....................egnheaahklevM......LSvlEGKRVVSLEYLNH
  425-  497 (53.04/15.75)	LEMWIARKQDFLNIA.....PMS...QNQNHMG..........................................mndpmmngehamlgngqvpnpygghpgyghqqyM......GP..PPPH.MQMHQPPM
  498-  569 (65.96/21.55)	...WHQQQHQQQQR.......MM...PQDHMMMQGGggpvHGMY....RGDMGH.........DPMTSPVNNHRH.....................apypnpaamrnnMrmpngpGP..IG...........
---------------------------------------------------------------------------


Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31421 with Med15 domain of Kingdom Metazoa



     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MSEEDWPSPKFREHVIQRLEPELARNRQNAPNLPVPGD
2) PSVLQPSQFHSPPCTTAALLGNTPAGGTPGYRAPVPPDPQPTSAQARNPPVTVATTQASTTPSAPNPPGGLPAPSASATAAVAAAVASFPSPDTSIRPGGQITPGSQAPGGGPTPAPNVPFPNGSSQMNGGPAMGQPPPQMGAPNMGGPPNGYGGYGMMNGPPGSGAPMGGNPYNQQIKKDMDQARPWDPSAHMYQQQPQWGAMPPQQPHGYPGRPMNGQGATPTGPSSVLESLINQPQQYPGHHNQMGPPGDRNVAAQRAAAQQQQQQQQQQQQQRPGMVPNQGMMSSEDQTVYSAKLRNMRGSCDSLRTRARQCRHEGNHEAAHKLEVM
3) QDFLNIAPMSQNQNHMGMNDPMMNGEHAMLGNGQVPNPYGGHPGYGHQQYMGPPPPHMQMHQPPMWHQQQHQQQQRMMPQDHMMMQGGGGPVHGMYRGDMGHDPMTSPVNNHRHAPYPNPAAMRNNMRMPNGPGPIGRDRNSMSGSSMSGPSSGAPSMNPMGTPNQKMGTPGSMGGMSGLDDLNYDDFLPNPTPIDALQPTLHVGQNSMNAGPPVQRSNLNETARKELQILDARFEID
1
77
433
38
407
670










Molecular Recognition Features






MoRF SequenceStartStop




NANANA