<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31418

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMAEDNSWKTSNFRQSVVNKINEAIQQTGMTSSKNGIEMENHVFHKARNKDEYLGFVARLILHVREMTAAAQQAQQDGGGNSSQQGGGGGGGGSGMPDPINALQNLASQGTRPQMMGQMGVGPGGPMGGQMGGAGQASNLLHSLRPQMQMGGMGGPMQGNRVGMGPGNQMGGMMGGPNQMQGPGAGMVGGMPGQMGVGMGPGGMSGGKIQMGVGPGGPNQMNPMVMGQIQAQLQNQNAMGGQQMGTVGGTMNAGNQMGQMVGANAGMNPQAMGMASNQVVRQQQLQQQGMGQVQMGLGPGQMGQLSAGVQGGVGHGGPAMQQQQQAGGMGPGAGPNQMNPGVAMGPGGVVGPAGGGGVMGPGPNQMLGAGGAGGPGAGQQGNFVGMGANAMVRKPPEMMPGGNVYPGSGGAVRSVTPNNFLRQSPSPSVPSPVGPGAHGPPSHPGQMIPSPALIPSPNPHMGGVAQRSTIGQSPGGSLNTPGQPGGAVPSPLNPQDEQLYREKYRALTKYIEPLKRMIAKMENDDIDKIAKMKRLLEILSNPSVRIPLETLHKCEAALTSQLGSIRETPTNNPLVEAVSSSLQAATGNHTLQRTFRPCLEALFGPDIKNLPPPAKQSRLALDDTGAAVGTGGGEIPHILQGEIARLDQKFKVSLDQCAISGTRTIKLICWLDDKNLPCVPPVAVTIPEDYPSTAPSCSLIEQEYNATPFLILVQKSLMARICKLPGLFTLSHLLDTWEMSVRQACSPNPTIVAPTGTSVLLGM
Length762
PositionTail
OrganismAnopheles gambiae (African malaria mosquito)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles.
Aromaticity0.03
Grand average of hydropathy-0.332
Instability index46.36
Isoelectric point9.03
Molecular weight78118.61
Publications
PubMed=12364791

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
ECO:0000250
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31418
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     182.49|      29|      29|     326|     354|       2
---------------------------------------------------------------------------
  197-  224 (54.55/13.52)	GMGPG.GMSGGK.....IQMG.VGPG.GPNQMNPMV
  309-  341 (46.78/10.41)	QGGVGhG..GPAmqqqqQAGG.MGPGAGPNQMNPGV
  342-  365 (45.04/ 9.71)	AMGPG.GVVGPA.....GGGGvMGPG..PNQM....
  431-  450 (36.12/ 6.14)	PVGPG...............A.HGPPSHPGQMIPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.57|      25|      75|     385|     418|       5
---------------------------------------------------------------------------
  385-  413 (41.74/33.53)	MGANAMVrkPP....................EMMPGGNvyPGSGG.AVRS
  422-  467 (31.83/ 7.10)	QSPSPSV..PSpvgpgahgppshpgqmipspALIPSPN..PHMGGvAQRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.48|      31|      43|     225|     265|       6
---------------------------------------------------------------------------
  225-  265 (43.58/25.76)	MG.QI..........QAQLQnQNAMGGQQMGtvggtMNAGnQMGQMvgaNAG
  266-  307 (49.90/12.61)	MNpQAmgmasnqvvrQQQLQ.QQGMGQVQMG.....LGPG.QMGQL...SAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.12|      15|     280|      86|     100|       7
---------------------------------------------------------------------------
   86-  100 (31.92/11.72)	GGGGGGGSGMPDPIN
  367-  381 (30.20/10.56)	GAGGAGGPGAGQQGN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.11|      16|      16|     510|     525|       9
---------------------------------------------------------------------------
  510-  525 (26.96/19.99)	IEPLKRMIAKMENDDI
  528-  543 (25.15/18.15)	IAKMKRLLEILSNPSV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31418 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MAEDNSWKTSNFRQSVVNKINEAIQQTGMTSSKNGIEMENHVFH
2) MTAAAQQAQQDGGGNSSQQGGGGGGGGSGMPDPINALQNLASQGTRPQMMGQMGVGPGGPMGGQMGGAGQASNLLHSLRPQMQMGGMGGPMQGNRVGMGPGNQMGGMMGGPNQMQGPGAGMVGGMPGQMGVGMGPGGMSGGKIQMGVGPGGPNQMNPMVMGQIQAQLQNQNAMGGQQMGTVGGTMNAGNQMGQMVGANAGMNPQAMGMASNQVVRQQQLQQQGMGQVQMGLGPGQMGQLSAGVQGGVGHGGPAMQQQQQAGGMGPGAGPNQMNPGVAMGPGGVVGPAGGGGVMGPGPNQMLGAGGAGGPGAGQQGNFVGMGANAMVRKPPEMMPGGNVYPGSGGAVRSVTPNNFLRQSPSPSVPSPVGPGAHGPPSHPGQMIPSPALIPSPNPHMGGVAQRSTIGQSPGGSLNTPGQPGGAVPSPLNPQDEQLYREK
1
66
44
502










Molecular Recognition Features






MoRF SequenceStartStop




NANANA