<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31417

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMAEDNSWKTPSFRQSVVNKINEAIQQSGMTSSKNGLEMENHVFQKARNKDEYLGYVARLILHVREMNTKNKNQQNPAGGSQDGGNPNQQGGMPDPINALQTLATQGTRPQMMGGQMGPGGPMGNQMGGGNASNLLNTLNRPQMPMTGGMANMQGRVGTMGGPNQMGGMMPGQMPQGMPGMPNQMGGAMGPGGMSGGKIVGQMNPMGQMNPMQMGVSGMPQGAGQQQPQQPQGQQGGPGGPNQMNPMGGMGMQVNPGGHMNQNAINQQMNQVGMSSGGNQMGNLGGNSPMNPGNMGIAPNQVIRQQMPPGMNPNQQQLGMAGGQMNQMNQGVGGPGGNLGPVQQQQQPGQVGMAGMGPGGPGNLQQQNNPQQQSQGGPNAAPGQMNQVGGPGGNMQAMGNQGNFVPIGANPMVRKQDMMSGGQVYPGGVVRSVTPNQFLRQSPSPSVPSPAGPGSIGPQSHPGQMIPSPALIPSPSPQVSSNIPAPRNIGQSPGQSLNTPGQAAAPSPLNPQEEHLYKEKYRSLQKYIEPLKRMIAKMEHDDVDKMGKMKRLLDILCNPTCRIPLETLYKCEAALTSQLGTIREPPLNNPLVEAVSANLQSPLGNHTLQRTFRPCLEALFGPDIKNLPTPAKQPRLAIDEPSTSGSTGSQEIPHILQGEIARLDQKFKVSLDPCAIGDTKTIKLICWLDDKHLPCVPPVAVTIPEEYPFTSPSCSLIEQEYNATPFLIQVQKSFLARICKLPEMFSLSHLLDTWEMSVRQACSPNPSLVAPSATSVLLGM
Length779
PositionTail
OrganismAedes aegypti (Yellowfever mosquito) (Culex aegypti)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Aedini> Aedes> Stegomyia.
Aromaticity0.03
Grand average of hydropathy-0.577
Instability index58.59
Isoelectric point8.89
Molecular weight82336.18
Publications
PubMed=17510324

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).
ECO:0000250	
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP31417
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     147.85|      34|      34|     441|     474|       2
---------------------------------------------------------------------------
  238-  278 (41.80/ 7.49)	GGPNQMNPmGGMGMQVNPGGHMNQNA.INQQmnqvgmsSG.GN
  445-  478 (60.26/14.72)	SVPSPAGP.GSIGPQSHPGQMIPSPALIPSP.......SP.QV
  479-  510 (45.79/ 9.05)	SSNIPA.P.RNIG.QS.PGQSLNTPGQAAAP.......SPlNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     311.85|      71|     115|     192|     306|       3
---------------------------------------------------------------------------
   86-  159 (68.41/10.83)	PNQQG..G.M.PdpinalqtlatQGTrpqmmgGQ.MGPGGPMG.....................................NQ.........M...G..GGNAsnllntlnrPQ....MPMT.GGMANMQGRVGT.M.....................
  181-  209 (42.95/ 9.65)	PNQMG..GaM..............GP......G.......................................................................................................gMSGgkivGQMNPMG...QMN
  210-  311 (115.79/27.54)	PMQMGVSG.M.P...........QGA......GQ.QQPQQPQGQ.QGGPggpnqmnpmggmgmqvnpgghmnqnainqqmNQvgmssggnQM...GNLGGNS.........PM....NPGN.MGIAPNQVIRQQ.M............PPG....MN
  349-  433 (84.70/15.93)	..QVGMAG.MgP...........GGP......GNlQQQNNPQQQsQGGP....................................naapgQMnqvGGPGGN...........MqamgNQGNfVPIGANPMVRKQdM.MSG....GQVYPGGvvrSVT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.38|      21|      23|     557|     579|       4
---------------------------------------------------------------------------
  557-  579 (34.14/23.23)	NPTCRIPLetLYKCEAALTSQLG
  583-  603 (37.23/19.70)	EPPLNNPL..VEAVSANLQSPLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.53|      17|      24|     659|     675|       5
---------------------------------------------------------------------------
  659-  675 (29.83/20.88)	IARLDQKFKVSLDPCAI
  684-  700 (34.70/25.57)	ICWLDDKHLPCVPPVAV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.33|      10|      24|     708|     717|       6
---------------------------------------------------------------------------
  708-  717 (18.73/12.79)	FTSPSCSLIE
  733-  742 (18.60/12.65)	FLARICKLPE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31417 with Med15 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MAEDNSWKTPSFRQSVVNKINEAIQQSGMTSSKNGLEMENHVFQ
2) VREMNTKNKNQQNPAGGSQDGGNPNQQGGMPDPINALQTLATQGTRPQMMGGQMGPGGPMGNQMGGGNASNLLNTLNRPQMPMTGGMANMQGRVGTMGGPNQMGGMMPGQMPQGMPGMPNQMGGAMGPGGMSGGKIVGQMNPMGQMNPMQMGVSGMPQGAGQQQPQQPQGQQGGPGGPNQMNPMGGMGMQVNPGGHMNQNAINQQMNQVGMSSGGNQMGNLGGNSPMNPGNMGIAPNQVIRQQMPPGMNPNQQQLGMAGGQMNQMNQGVGGPGGNLGPVQQQQQPGQVGMAGMGPGGPGNLQQQNNPQQQSQGGPNAAPGQMNQVGGPGGNMQAMGNQGNFVPIGANPMVRKQDMMSGGQVYPGGVVRSVTPNQFLRQSPSPSVPSPAGPGSIGPQSHPGQMIPSPALIPSPSPQVSSNIPAPRNIGQSPGQSLNTPGQAAAPSPLNPQEEHL
1
63
44
515

Molecular Recognition Features

MoRF SequenceStartStop
NANANA