<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31402

Description Putative mediator of RNA polymerase II transcription subunit 14
SequenceMDQNQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPPNGMMPMNGEQTTPIIPQNRNISLSLVIHRLVEQSYNSLLGLTEGLPKANDLERKKAIVDYLDGTREKFLRLMVLIKWSEHVPTLTKANNIIDILNLEDSYLREAADLLINTQFSLVNARAPIYDVPTAIDVLTTGTYQRMPTNIKRVIPPPPLKPTQIESALERLNDIIKYKLFISDVPKEFQPITVSDGKAHIFVDDEYEAYLTIDGGSEKSNWVILSLNLFVYSKRNLNGEGPIKVAYDNKMKYVLDRVQNRIISSAQPLFELHNIVHYLCISSQMDILASQVENLKKTILKNNIRCVFGKDQSITVFYWLPEDFNLVGVTQHTLGNLMPNKHTNFKIYIDEHQKIKISHYPPITHPKNENYFKIASLNLETILLQAIELNAYDKVYLLNSLLLDNRITANTTSSSSSSSSNNNNTASPIINRNNNNGKPNLLSTKQSNNPLSRSFHLNDIKLIMSSRFSDENQNDSNGNNDHLPTVLRVMLYGSKFLDITVNFQNGKFSLIKSSNYIEFTNHLEQRLNKDPNEIESIVNVFKLKSLLTCFEEASLFLGLECFNKIPLQMNSSNNSESNQLANELFSDSNFICVSISLAKENNPYYLVISIKATCFTPSFHLLFCKMLPKSTIMTLDSIIKLESDQLNKLLKECPIGSISSSNNTNSNGNGPFQSYISTLLEKIVEASNQKINLLSIQSFLKKENINYYQPSQQDIENNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGNNGYKNNGITTTTSIVFLFNEQQIQKISPFLSNHISHQTPITISFKNGFYTLSFTQQRPFEYKKYGSGSNININSFGENNSNENYIYRKGNWIFKYQQTSDWFNSFCNDLMTISKITNISSQLLKQMETLEIYKQLITHLTIKPMSIEFVCFVGSNQTRTNVIMFVEKKTAEIKLSFQPYSNPLLVYLEKDINQSPTNDITNSLRAIINSNDISVYINSLISPLELSFYLPLEILVIPRSICQIRLLYKNLYGIDIKLISHEYCAISDSFYSLNSSKQVRLTSINQLHSFMEQRVSLQALDNPTGHRTSWLLPIKQFQKTISRIFIYLNSLNTLKFAQNLMKPNFQPLVPSNPSSQKFSNDYFIVSFSIRDYTSFDIDVTNKNLENSVPSNEELALFCQYFKKKVQQLNYRSQTIGSCIQMLTLPPKILWEFIRVLLEITGPKFDGYTIEISLNTSSIHSKNKESFFHIPDENQVYFILRYLNSSRTDIIPPDQFTDIPIIYNYNEKSIRYWNKLDSNSTSSSSSSTLPKKSLSIVEEVKQKFVEEVAKLIPDALNASSGKSSPISIFFKSFLPKIKPIFSNPTASTLLLIQQQQQQQQQQQQQQQQQQQQQQIENNNFASASSSIR
Length1420
PositionTail
OrganismDictyostelium discoideum (Slime mold)
KingdomAmoebozoa
LineageEukaryota> Amoebozoa> Evosea> Eumycetozoa> Dictyostelia> Dictyosteliales> Dictyosteliaceae> Dictyostelium.
Aromaticity0.09
Grand average of hydropathy-0.498
Instability index43.47
Isoelectric point8.52
Molecular weight162894.12
Publications
PubMed=15875012
PubMed=18515835

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	ISS:dictyBase

GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31402
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     106.17|      15|      15|       5|      19|       2
---------------------------------------------------------------------------
   13-   28 (32.46/14.73)	QQQQQQQqQQQQQQQQ
   29-   43 (36.86/17.48)	QQQQQQQ.QQQQQQQQ
 1392- 1406 (36.86/17.48)	QQQQQQQ.QQQQQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.36|      15|      15|     770|     784|       3
---------------------------------------------------------------------------
  770-  784 (31.38/12.34)	NNNNNNNNNNNNNNN
  786-  800 (31.98/12.73)	NNNNNNNGNNGYKNN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.38|      23|      27|     494|     516|       4
---------------------------------------------------------------------------
  494-  516 (40.57/24.95)	HLNDIKLIM..SSRFSDENQNDSNG
  520-  544 (33.81/19.28)	HLPTVLRVMlyGSKFLDITVNFQNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.30|      16|      21|    1035|    1053|       5
---------------------------------------------------------------------------
 1035- 1053 (23.06/27.68)	CQIRllyKNLYGID....IKLIS
 1057- 1076 (22.25/14.80)	CAIS...DSFYSLNsskqVRLTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.73|      28|      35|     949|     982|       6
---------------------------------------------------------------------------
  949-  982 (37.11/39.87)	NQTRTNVImfVEKKTA.....EIKLsfqpYSNPLLVYLE
  986- 1018 (42.62/25.66)	NQSPTNDI..TNSLRAiinsnDISV....YINSLISPLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.75|      18|      21|     215|     235|       7
---------------------------------------------------------------------------
  215-  235 (25.27/23.93)	KYKLFISDvpkEFQPITVSDG
  236-  253 (29.48/17.92)	KAHIFVDD...EYEAYLTIDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      87.56|      19|      21|     846|     864|       8
---------------------------------------------------------------------------
  812-  834 (20.56/ 7.43)	.FNEQQiqkisPFLSNHISHQTPI
  846-  864 (33.63/17.19)	SFTQQR.....PFEYKKYGSGSNI
  868-  886 (33.37/16.99)	SFGENN.....SNENYIYRKGNWI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.90|      18|      22|     409|     428|       9
---------------------------------------------------------------------------
  409-  428 (25.39/26.10)	YFKIASLNleTILLQA.IELN
  430-  448 (26.50/18.79)	YDKVYLLN..SLLLDNrITAN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.96|      33|      35|    1307|    1341|      10
---------------------------------------------------------------------------
 1309- 1341 (50.76/28.50)	DSNSTSSSSSSTLPKKSLSIVEEVKQKFVEEVA
 1346- 1378 (52.21/23.91)	DALNASSGKSSPISIFFKSFLPKIKPIFSNPTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.63|      10|      33|     565|     574|      13
---------------------------------------------------------------------------
  548-  557 (17.31/10.03)	LIKSSNYIEF
  565-  574 (18.32/11.15)	LNKDPNEIES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.52|      13|      23|     663|     675|      16
---------------------------------------------------------------------------
  663-  675 (22.61/13.21)	KMLPKSTIMTLDS
  686-  698 (20.91/11.66)	KLLKECPIGSISS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.38|      35|      36|    1111|    1145|      17
---------------------------------------------------------------------------
 1111- 1145 (60.96/40.95)	QKTISRIFIYLNSL.NTLKFAQNLMKPNFQPLVPSN
 1149- 1184 (56.42/37.22)	QKFSNDYFIVSFSIrDYTSFDIDVTNKNLENSVPSN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.90|      16|      23|     704|     720|      19
---------------------------------------------------------------------------
  704-  720 (23.34/15.81)	SNGNGPFQSyISTLLEK
  725-  740 (24.56/11.55)	SNQKINLLS.IQSFLKK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31402 with Med14 domain of Kingdom Amoebozoa
Unable to open file!