<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31392

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMPGVVMDNANIGGLRHGPGNTYPQDGLSHSRGEVAQFNGANAQDGPVHVNGVEKNASQSRSVEAIPSNHASRVTKGPPELPHITQGFFPFAKLVNRSVQQCWNDLSDLITEMAEMQVNSHGIHPSTAPTTGKSPGNQSPGNIRKKLRILEFSHAKRAEFIKLLVLSQWSRQAADVSKLIDIQNFIRTRHQAYTNALQWVGDMKRDLVQAQVANPDLKTALEVLSRGKVASMSDLGYKPPRRLTVRGTLRKLQKINRLIGARLVVQDEIPPPFKSYRVHDGRVTFAVPGEFELDLSIGEENENSQFFFVDIRFLFSPSPPILKGRLLNELEMTINDVLQNSGLTGCFDLLHNLVLTNKINILFKQATELARSSWSDGLRVELLHRTLVVQYWTLKPGTKSWLEIGIKSGHRKSDSESPGLPSLKFRWVRDGGEVPCEDIAFDAKNLSMETVLRSVIALHVSHTLSSAYCKIRQSSLFSTGFLSLRAHLTRTEPGDCQLDVQLTETRHLQVSIEPMSGVSILSAKPTVSDRFDMERNPERSSVEDIVSRVARIRCNAAIEEIESKVKMLGFEPLNPRAWKLDIRRIFPPNFLRFTLFSHQLWGRSWIVAATSSMDGDSWWVVQLRPTLPAKGPPIPHANGYGQPILRSAQVVTDSFFPARYDIDDAYLANLGHSLSGILAIQSNARYLSDLQSIKFHPPPHKLKIEPDLRVPDILVRYDVSTLPSVFRVAMPAKAKKKSLIRDTIRLAFHGVDPREKCAIMVAYGNLVDSTATLCPLISSWDRSLVFQKGGTGFAMRLLAPAGHPVIVSLLENLQRLECVLSILETLQRKKVEIRTFSLSSISFIYGSERDLAASLNIHLSRNESLMKLSPTDLASRREFLFGLRLGIQFGLQNPHRRIQESLASSLNRSPTEAGLETVVELLTLTLPLMRALDQLMANPSHSGPLRLHVTVRNAKTYQLHYPGDEARFQLVAASHQNRLVWVLKDANSQGNSKNDDSITARLRQTLYTSKGDGWKGLETGVVAEVDQVGNLLRELEKCFVASRADRADPKHKPTDYAANHTGLNNPEISALAIKKGTTDGAKLSLSDSLTTLPNDKGNLSQADTAAQKEDIIMID
Length1114
PositionTail
OrganismAspergillus niger (strain CBS 513.88 / FGSC A1513)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati.
Aromaticity0.07
Grand average of hydropathy-0.272
Instability index44.21
Isoelectric point9.30
Molecular weight123841.25
Publications
PubMed=17259976

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
ECO:0000250
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31392
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.67|      19|      30|     684|     702|       1
---------------------------------------------------------------------------
  684-  702 (36.22/27.12)	RY.LSDLQSIKFHPPPHKLK
  715-  734 (26.45/17.41)	RYdVSTLPSVFRVAMPAKAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.62|      25|      30|     141|     168|       2
---------------------------------------------------------------------------
  141-  168 (36.33/32.72)	NIRKKLRILEFSHAKRAEFIKLLvlsQW
  174-  198 (43.29/30.19)	DVSKLIDIQNFIRTRHQAYTNAL...QW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.22|      28|      34|     923|     953|       3
---------------------------------------------------------------------------
  923-  953 (40.34/40.37)	LTLPLMRALDQLMAnPSHSGplRLHVTVRNA
  958-  985 (50.88/36.21)	LHYPGDEARFQLVA.ASHQN..RLVWVLKDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.90|      23|      34|     842|     864|       4
---------------------------------------------------------------------------
  842-  864 (38.93/28.09)	FIYGSERDLAASL.NIHLSRNESL
  878-  901 (36.96/26.23)	FLFGLRLGIQFGLqNPHRRIQESL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.36|      13|      34|     291|     303|       5
---------------------------------------------------------------------------
  291-  303 (21.46/14.99)	ELDLSIGEENENS
  328-  340 (21.90/15.46)	ELEMTINDVLQNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.11|      19|      34|      45|      75|       8
---------------------------------------------------------------------------
   28-   46 (34.31/14.15)	SHSRG.EVAQFNGAN.AQDGP
   57-   77 (24.81/37.29)	SQSRSvEAIPSNHASrVTKGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.41|      11|     626|     220|     234|      12
---------------------------------------------------------------------------
  206-  216 (18.86/11.17)	LVQAQVAN.PDL
  223-  234 (13.55/ 7.68)	LSRGKVASmSDL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31392 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AEMQVNSHGIHPSTAPTTGKSPGNQSPGNIRK
2) VMDNANIGGLRHGPGNTYPQDGLSHSRGEVAQFNGANAQDGPVHVNGVEKNASQSRSVEAIPSNHASRVTKGPPE
113
5
144
79










Molecular Recognition Features






MoRF SequenceStartStop




1) KEDIIMI
1107
1113