<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31367
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MATYSLANERLRALEDIEREIGAILQNAGTAILELSKEKTNERLLDRQAAAFTTSVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKISDVARTCEQMLEN |
| Length | 117 |
| Position | Head |
| Organism | Mus musculus (Mouse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.476 |
| Instability index | 31.34 |
| Isoelectric point | 5.71 |
| Molecular weight | 13130.67 |
| Publications | PubMed=16141072
PubMed=19468303
PubMed=15489334
PubMed=21183079
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 ISO:MGI
nucleoplasm GO:0005654 TAS:Reactome
ubiquitin ligase complex GO:0000151 ISO:MGI
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | protein ubiquitination GO:0016567 ISO:MGI
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31367
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.55| 24| 31| 8| 36| 1
---------------------------------------------------------------------------
8- 36 (32.41/33.26) NERLraledIEREIGAILQNAGTAILELS
41- 64 (39.14/26.72) NERL.....LDRQAAAFTTSVQHVEAELS
---------------------------------------------------------------------------
|