Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MATYSLANERLRALEDIEREIGAILQNAGTAILELSKEKTNERLLDRQAAAFTTSVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKISDVARTCEQMLEN |
Length | 117 |
Position | Head |
Organism | Mus musculus (Mouse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Mus> Mus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.476 |
Instability index | 31.34 |
Isoelectric point | 5.71 |
Molecular weight | 13130.67 |
Publications | PubMed=16141072 PubMed=19468303 PubMed=15489334 PubMed=21183079 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 ISO:MGI nucleoplasm GO:0005654 TAS:Reactome ubiquitin ligase complex GO:0000151 ISO:MGI |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | protein ubiquitination GO:0016567 ISO:MGI regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions | [Q9D8C6<-->Q9NVC6: MED17] Xeno NbExp=2, [Q9D8C6<-->Q15528: MED22] Xeno NbExp=2, [Q9D8C6<-->Q9H204: MED28] Xeno NbExp=2, [Q9D8C6<-->Q9NX70: MED29] Xeno NbExp=2, |
Repeats | >MDP31367 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 71.55| 24| 31| 8| 36| 1 --------------------------------------------------------------------------- 8- 36 (32.41/33.26) NERLraledIEREIGAILQNAGTAILELS 41- 64 (39.14/26.72) NERL.....LDRQAAAFTTSVQHVEAELS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ERLLDR 2) LSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKISDVARTC | 42 63 | 47 111 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab