Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN |
Length | 117 |
Position | Head |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.440 |
Instability index | 31.34 |
Isoelectric point | 5.71 |
Molecular weight | 13128.69 |
Publications | PubMed=15489334 PubMed=12584197 PubMed=15175163 PubMed=15989967 PubMed=22814378 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IDA:MGI ubiquitin ligase complex GO:0000151 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro ubiquitin protein ligase activity GO:0061630 IEA:Ensembl |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions | [Q9P086<-->Q9NYB9-2: ABI2] NbExp=3 EBI-394704,EBI-11096309 [Q9P086<-->Q96HB5: CCDC120] NbExp=3 EBI-394704,EBI-744556 [Q9P086<-->P23434: GCSH] NbExp=3 EBI-394704,EBI-715444 [Q9P086<-->Q15528: MED22] NbExp=3 EBI-394704,EBI-394687 [Q9P086<-->Q9GZM8: NDEL1] NbExp=3 EBI-394704,EBI-928842 [Q9P086<-->Q9Y5B8: NME7] NbExp=3 EBI-394704,EBI-744782 [Q9P086<-->Q96ES7: SGF29] NbExp=3 EBI-394704,EBI-743117 [Q9P086<-->A1L4H1: SSC5D] NbExp=3 EBI-394704,EBI-10172867 [Q9P086<-->Q6PIF2: SYCE2] NbExp=3 EBI-394704,EBI-11958386 [Q9P086<-->Q8N6Y0: USHBP1] NbExp=3 EBI-394704,EBI-739895 |
Repeats | >MDP31365 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.53| 24| 31| 8| 36| 1 --------------------------------------------------------------------------- 8- 36 (33.02/36.13) NERLraledIEREIGAILQNAGTVILELS 41- 64 (39.51/28.91) NERL.....LDRQAAAFTASVQHVEAELS --------------------------------------------------------------------------- |
Disease |
MoRF Sequence | Start | Stop |
1) SAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVAR | 64 | 109 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab