<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31358
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MEPNPSDPVLTDRIQAIVTTEKSIDEMMKCAREIIQDLGKEKQIGKNKMEDNANNFKKLITQVENELSAQMQYLSHVCVGSSHQGSTFGVLQNSLLAQSGLSSLHSELFQIVRYLDPTSDEPQTTEEDEEDGSDDLNEDGADGAPSSTVTSSTTDGSGGGDDAASSSAPRSQEESGRQMTDDDDDMEQ |
| Length | 188 |
| Position | Head |
| Organism | Caenorhabditis elegans |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.855 |
| Instability index | 46.23 |
| Isoelectric point | 4.08 |
| Molecular weight | 20338.65 |
| Publications | PubMed=9851916
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | multicellular organism development GO:0007275 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31358
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.60| 21| 21| 131| 151| 1
---------------------------------------------------------------------------
120- 142 (27.80/12.13) DEPQTT.EEdeeDGSDDLNEDGAD
143- 162 (25.38/10.50) GAPSSTVTSsttDGSGG....GDD
163- 185 (28.43/12.55) AASSSAPRS.qeESGRQMTDDDDD
---------------------------------------------------------------------------
|