Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MDPQTQNTSLQRLQNVENRVVKVLELAGGVMEELASPSGPKKEFVNSHCREFMQSMKDIQVTLREEIKSACEYRPFEKCDYNARIANEICFQKLEYVLTQLEDLKQTADRYPSSD |
Length | 115 |
Position | Head |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.696 |
Instability index | 44.52 |
Isoelectric point | 5.09 |
Molecular weight | 13321.95 |
Publications | PubMed=11130713 PubMed=27862469 PubMed=17560376 PubMed=22021418 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IDA:UniProtKB |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions | [Q6ID77<-->Q8RXD6: HUB1] NbExp=2 EBI-1386244,EBI-2012188 [Q6ID77<-->Q8LCH5: MED22B] NbExp=3 EBI-1386244,EBI-1386287 [Q6ID77<-->F4IXJ7: MED6] NbExp=3 EBI-1386244,EBI-1386187 |
Repeats | >MDP31354 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) DIQVTLREEIK 2) EYRPFEKCDY 3) PKKEFVNSHCREF 4) TADRYP | 58 72 40 107 | 68 81 52 112 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab