Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MLPQDDMTDEMKSLASRLEDTTQAFYDLALIVYNLEDTTPSDAIPESLDTLIRDLKSLPDISRKVNNLIPQDVLEYIEQGRNPDVYARQFSELVQKDNQYVNGKLYAIEGFQKAFAEEIKQAYPEVSSVVDKILNEGKVESTVS |
Length | 144 |
Position | Middle |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae> Schizosaccharomyces. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.465 |
Instability index | 40.57 |
Isoelectric point | 4.29 |
Molecular weight | 16338.09 |
Publications | PubMed=11859360 PubMed=21511999 PubMed=10625684 PubMed=11572939 PubMed=16823372 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central cytosol GO:0005829 HDA:PomBase mediator complex GO:0016592 IDA:PomBase nuclear envelope GO:0005635 HDA:PomBase nucleus GO:0005634 HDA:PomBase P:positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IPomBase |
GO - Biological Function | transcription coactivator activity GO:0003713 TAS:PomBase transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IC:PomBase |
Binary Interactions |
Repeats | >MDP31348 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 75.48| 21| 22| 59| 80| 1 --------------------------------------------------------------------------- 59- 80 (30.76/26.39) PDI.SRKVNNLIPQDVLEYIEqG 83- 103 (27.04/17.66) PDVyARQFSELVQKDN.QYVN.G 124- 140 (17.68/ 8.92) PEV.SSVVDKILNEGKVE..... --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AIPESLDTLIRDLK 2) FYDLALIVYNL 3) ISRKVNNLIPQDV 4) KSLASRL | 43 25 61 12 | 56 35 73 18 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab