<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31344
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPVTATHQEAQESVKNVIQDLLNLMVQVSQYDTNPSSSNNNTPTSSRASGGGGGGGGGHASSRDIIAQSLQTLDASLLSVYRTANLLPSSPSSGPSNNQPQQGTTELERAEAAQFASTFNNTHNPYAPHVHQPGPQNPGIPIPLITYVENGRNPDVYTREFIELVRRSNQLMRGKMHAFRDFRDVLAGEMEAALPELREDIKRVVEATGGPGPAEGSEERAREGVVGSLSAGGEGQQGQGQGQQGQGQQSGQ |
| Length | 253 |
| Position | Middle |
| Organism | Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Sordariaceae> Neurospora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.716 |
| Instability index | 54.29 |
| Isoelectric point | 5.25 |
| Molecular weight | 26751.88 |
| Publications | PubMed=12712197
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31344
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.91| 23| 157| 49| 71| 1
---------------------------------------------------------------------------
49- 71 (40.88/16.68) ASGGGGGGGGGHASSRDIIAQSL
208- 230 (39.02/15.63) ATGGPGPAEGSEERAREGVVGSL
---------------------------------------------------------------------------
|