Description | Isoform 2 of Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAEKFDNLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMITGLQDIEKCRQQLHDINVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTLTKFKSLLISELGKVFPEEMAKYKAIHGDDPPS |
Length | 106 |
Position | Middle |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes> Danionidae> Danioninae> Danio. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.544 |
Instability index | 42.17 |
Isoelectric point | 5.24 |
Molecular weight | 15437.48 |
Publications | PubMed=17208216 PubMed=23594743 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity). Negatively
regulates the Wnt signaling pathway and positively regulates the Nodal
signaling pathway. Required for cardiac cushion formation.
ECO:0000250 ECO:0000269 PubMed:17208216 |
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | atrioventricular canal development GO:0036302 IMZFIN cardiac jelly development GO:1905072 IMZFIN heart development GO:0007507 IMZFIN positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central Wnt signaling pathway GO:0016055 IEA:UniProtKB-KW |
Binary Interactions |
Repeats | >MDP31337 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) AKYKAIHG 2) LERALAK | 122 85 | 129 91 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab