<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31337
| Description |
Isoform 2 of Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAEKFDNLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMITGLQDIEKCRQQLHDINVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTLTKFKSLLISELGKVFPEEMAKYKAIHGDDPPS |
| Length | 106 |
| Position | Middle |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.544 |
| Instability index | 42.17 |
| Isoelectric point | 5.24 |
| Molecular weight | 15437.48 |
| Publications | PubMed=17208216
PubMed=23594743
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity). Negatively
regulates the Wnt signaling pathway and positively regulates the Nodal
signaling pathway. Required for cardiac cushion formation.
|
| GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | atrioventricular canal development GO:0036302 IMZFIN
cardiac jelly development GO:1905072 IMZFIN
heart development GO:0007507 IMZFIN
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
Wnt signaling pathway GO:0016055 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP31337
No repeats found
No repeats found
|