<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31312
| Description |
Probable mediator of RNA polymerase II transcription subunit 26b |
| Sequence | MKASGSLDSWREYFRRRGDSDIFGIIDHAIMVAATDCPNKFKSRRDKIAELLFSCRVNRCVGCDHLELSVPGDDEANRGTTGNGGGGTAVDEDYEVAGGSKESKANSSRGDNNQIVSNYTFDEAEALSDEIEEFSVVSKEVARIKEILLNKEDEPNSVLLDSLRHLKLMSLNVDILKSTEIGKAVNGLRKHSSDKIRQLAKTLIAEWKELVDQWVNTTKEITGAEGTPESANPSVLDEEEAFPSLPYDVDIFTPEPNGFEISHFFDSLDFDGNPRNSEEHNTSREHERRPQNIAKRKPEGTQMRIQDAPFRSIKPSSATDFDGTRRPVKQSTEQRMKNETVSVHKSEKPMIQRKPVVTEQKRKAPGPQQEKLKGLDADAKFEFAKRKLQESYQHHENAKKQRTIQVLEMIPKQGSAQKPQLKRPGMSNRNWANGRK |
| Length | 436 |
| Position | Unknown |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.917 |
| Instability index | 49.67 |
| Isoelectric point | 6.60 |
| Molecular weight | 49134.33 |
| Publications | PubMed=10470850
PubMed=27862469
PubMed=14593172
PubMed=22021418
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors (By similarity). May play a role in transcription
elongation (By similarity).
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31312
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 163.15| 45| 48| 265| 311| 1
---------------------------------------------------------------------------
225- 260 (36.98/17.63) ......EGTP......ESANPSvldEE....EafP.SLPYDVDIFTPEPN........GFE
265- 311 (79.25/51.03) FDSLDFDGNPR...NSEEHNTS...RE....H..E.RRPQNIAKRKPEGT.QMRiqDAPFR
316- 365 (46.92/24.21) SSATDFDGTRRpvkQSTEQRMK...NEtvsvH..KsEKP..MIQRKPVVTeQKR..KAP..
---------------------------------------------------------------------------
|