<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31311
| Description |
Probable mediator of RNA polymerase II transcription subunit 26a |
| Sequence | MAKMRPSVSLDTWREYFRRGDSDIFGIIDHAIMVAAADWPKEFKSRSDRIAELLFSCKVSRCIGCDHLELSIAGDEAAVEIVGVGGGGDRGDSGVATGEGEEASVSVDEVMRIRDILSNKDDEKDSVLLESLRKLESMSMSVDILKDTEIGKAVNGLRRHSSDKISKLAKTLFAEWKRLVDQWMNTPEEMAGTEGTPESLNLSVIDEEEAFPSPPHDLDIYAPEPNGFELSQILDCLDCDGNPRHSVESKHERKSQSSAGRRPKGTNDANVVGRYCNDQQTRREEADVRPMKHSATDVVEPKRQTKQSREQMVSAIQRKPTAVTEQKRKLAGPQQDKLKALDPDSKFEFAKRKLQESYHQHENAKRQRTIQVLETIPKQNKVQKPQLKRPATRRYIYWYFWSSEFPGYELPSLILNLANPRDSSSQFSRHDELMIDIPVYFGLVLVQIDKAEMVDEMMIFKKMSVLLTEKDFVDAIVSVSLKDLTRSLFVRFEAKACPKFDLIHKTSVETVRCVGKTFMHMLSKVSREFPPRNRTHPGGLLYQRFDPTHLSLARQQVAICKETDSQYPHEIVIHWTSASA |
| Length | 580 |
| Position | Unknown |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.584 |
| Instability index | 50.02 |
| Isoelectric point | 6.50 |
| Molecular weight | 65871.10 |
| Publications | PubMed=11130713
PubMed=27862469
PubMed=22021418
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors (By similarity). May play a role in transcription
elongation (By similarity).
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31311
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.86| 20| 22| 285| 304| 1
---------------------------------------------------------------------------
285- 304 (34.70/25.47) EADVRPMKHSATDVVEPKRQ
310- 329 (33.16/24.01) EQMVSAIQRKPTAVTEQKRK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.42| 23| 27| 197| 219| 3
---------------------------------------------------------------------------
197- 219 (40.65/26.72) PESLNLS.VIDEEEAFPSPPHDLD
225- 248 (38.78/25.16) PNGFELSqILDCLDCDGNPRHSVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.91| 21| 21| 64| 84| 6
---------------------------------------------------------------------------
64- 84 (35.06/24.74) GCDHLELSIAGDEAAVEIVGV
87- 107 (34.84/24.55) GGDRGDSGVATGEGEEASVSV
---------------------------------------------------------------------------
|