Description | Probable mediator of RNA polymerase II transcription subunit 26a |
Sequence | MAKMRPSVSLDTWREYFRRGDSDIFGIIDHAIMVAAADWPKEFKSRSDRIAELLFSCKVSRCIGCDHLELSIAGDEAAVEIVGVGGGGDRGDSGVATGEGEEASVSVDEVMRIRDILSNKDDEKDSVLLESLRKLESMSMSVDILKDTEIGKAVNGLRRHSSDKISKLAKTLFAEWKRLVDQWMNTPEEMAGTEGTPESLNLSVIDEEEAFPSPPHDLDIYAPEPNGFELSQILDCLDCDGNPRHSVESKHERKSQSSAGRRPKGTNDANVVGRYCNDQQTRREEADVRPMKHSATDVVEPKRQTKQSREQMVSAIQRKPTAVTEQKRKLAGPQQDKLKALDPDSKFEFAKRKLQESYHQHENAKRQRTIQVLETIPKQNKVQKPQLKRPATRRYIYWYFWSSEFPGYELPSLILNLANPRDSSSQFSRHDELMIDIPVYFGLVLVQIDKAEMVDEMMIFKKMSVLLTEKDFVDAIVSVSLKDLTRSLFVRFEAKACPKFDLIHKTSVETVRCVGKTFMHMLSKVSREFPPRNRTHPGGLLYQRFDPTHLSLARQQVAICKETDSQYPHEIVIHWTSASA |
Length | 580 |
Position | Unknown |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.584 |
Instability index | 50.02 |
Isoelectric point | 6.50 |
Molecular weight | 65871.10 |
Publications | PubMed=11130713 PubMed=27862469 PubMed=22021418 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors (By similarity). May play a role in transcription
elongation (By similarity).
ECO:0000250 |
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP31311 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.86| 20| 22| 285| 304| 1 --------------------------------------------------------------------------- 285- 304 (34.70/25.47) EADVRPMKHSATDVVEPKRQ 310- 329 (33.16/24.01) EQMVSAIQRKPTAVTEQKRK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 79.42| 23| 27| 197| 219| 3 --------------------------------------------------------------------------- 197- 219 (40.65/26.72) PESLNLS.VIDEEEAFPSPPHDLD 225- 248 (38.78/25.16) PNGFELSqILDCLDCDGNPRHSVE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.91| 21| 21| 64| 84| 6 --------------------------------------------------------------------------- 64- 84 (35.06/24.74) GCDHLELSIAGDEAAVEIVGV 87- 107 (34.84/24.55) GGDRGDSGVATGEGEEASVSV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ATRRYIYWYFWSSE 2) HDLDIY | 391 216 | 404 221 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab