<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31306
| Description |
Mediator of RNA polymerase II transcription subunit 19-B |
| Sequence | MTEIFSSLYGQPDSQGPAGPSALGFGSGKPQVPQNMGPMCFPHQMMEEGAPVRKPAAMNEPFYLLRELPMENELTGHTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGIQDNSSLRSLIEKPPVCNNSFSPLTGAMLTGFRLHTGPLPEQYRLMHIQPPKKKNKHKHKHHRPQDPLPPETPSDSDHKKKKKKKDDDPDRKKKKKDKKKKKNRHSPDHPGMTGAQPSTSSLR |
| Length | 240 |
| Position | Head |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.105 |
| Instability index | 57.23 |
| Isoelectric point | 9.67 |
| Molecular weight | 27004.74 |
| Publications | PubMed=15256591
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31306
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.62| 14| 18| 167| 183| 1
---------------------------------------------------------------------------
167- 180 (29.10/ 8.46) PPKKKNK..HKHKHHR
186- 201 (18.52/ 6.14) PPETPSDsdHKKKKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.22| 27| 114| 96| 125| 2
---------------------------------------------------------------------------
96- 125 (45.47/28.83) KKVKEKLSN.FLPELPGMidsPGIQ.DNSSLR
212- 240 (42.75/20.53) KKDKKKKKNrHSPDHPGM...TGAQpSTSSLR
---------------------------------------------------------------------------
|