Description | Probable mediator of RNA polymerase II transcription subunit 19b |
Sequence | MESESVKFGGPRELGGALDLITQYKLLPHHEFFCKRSLPESLSDAHYLHNLVGDTEIRKGEGMQLDQLIPNASLSSRDTNARIQPFVLDELKEAFELNDTAPVELPPAEKGAPTTVSKSKSESKDKDRKHRKHKDKKEKDREHKKHKHKHKDRIKDKDKDKDRDKKKEKSGHHDKKRKNNGTEDADDVQRHKKSKHKSSKLDEMGAM |
Length | 207 |
Position | Head |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis. |
Aromaticity | 0.03 |
Grand average of hydropathy | -1.480 |
Instability index | 35.11 |
Isoelectric point | 9.36 |
Molecular weight | 23823.55 |
Publications | PubMed=11130714 PubMed=27862469 PubMed=14593172 PubMed=22021418 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31305 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 71.89| 20| 21| 134| 153| 1 --------------------------------------------------------------------------- 134- 153 (39.78/15.97) KDK.KEKDREHKKHKHKHKDR 155- 175 (32.11/11.60) KDKdKDKDRDKKKEKSGHHDK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EMGAM 2) KDKDRKHRKHKDKKEKDREHKKHKHKHKDRIKDKDKDKDRDKKKEKSGHHDKKRKN | 203 124 | 207 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab