| Description | Probable mediator of RNA polymerase II transcription subunit 19b |
| Sequence | MESESVKFGGPRELGGALDLITQYKLLPHHEFFCKRSLPESLSDAHYLHNLVGDTEIRKGEGMQLDQLIPNASLSSRDTNARIQPFVLDELKEAFELNDTAPVELPPAEKGAPTTVSKSKSESKDKDRKHRKHKDKKEKDREHKKHKHKHKDRIKDKDKDKDRDKKKEKSGHHDKKRKNNGTEDADDVQRHKKSKHKSSKLDEMGAM |
| Length | 207 |
| Position | Head |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.480 |
| Instability index | 35.11 |
| Isoelectric point | 9.36 |
| Molecular weight | 23823.55 |
| Publications | PubMed=11130714 PubMed=27862469 PubMed=14593172 PubMed=22021418 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP31305
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.89| 20| 21| 134| 153| 1
---------------------------------------------------------------------------
134- 153 (39.78/15.97) KDK.KEKDREHKKHKHKHKDR
155- 175 (32.11/11.60) KDKdKDKDRDKKKEKSGHHDK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EMGAM 2) KDKDRKHRKHKDKKEKDREHKKHKHKHKDRIKDKDKDKDRDKKKEKSGHHDKKRKN | 203 124 | 207 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab