Description | Mediator of RNA polymerase II transcription subunit 19-A |
Sequence | MTEIFSTLFGQNDAQPPSGPAALGFAPGKPPPSMPPNQAPIAAQMPGQLGDDGPLLRKPGAMNEPFYLLRELPVGNDLTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHRHHHPQDPLPLETRTDPTKKKKKKDNEPERRKKKKDKKKKKNRHSPDHPGVTGSQPNSNSLR |
Length | 242 |
Position | Head |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes> Danionidae> Danioninae> Danio. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.984 |
Instability index | 54.49 |
Isoelectric point | 9.85 |
Molecular weight | 26817.52 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31304 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.38| 15| 15| 194| 208| 2 --------------------------------------------------------------------------- 194- 208 (26.43/13.12) RTDPTKKKKKKDNEP 212- 226 (25.95/12.77) KKKKDKKKKKNRHSP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.92| 10| 15| 163| 172| 3 --------------------------------------------------------------------------- 163- 172 (20.73/11.09) QYRLMHIQPP 179- 188 (22.19/12.37) KHRHHHPQDP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKKKKKDNEPERRKKKKDKKKKKNRHS 2) YRLMHIQ | 199 164 | 225 170 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab