<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31303
| Description |
Mediator of RNA polymerase II transcription subunit 19a |
| Sequence | MEPERLKFGGPRELCGAADLISQFKLVQHHEFFCKKSLPVSLSDSHYLHNVVGDTEIRKGEGMQLDQLIESISQSRETNIRIQPFDIDELQESFQLNDMTPVELPPAEKGAPTIPSKSKSESKDRDRKHKKHKDRDKDKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDSGDHSKKHHDKKRKHDGDEDLNDVQRHKKNKHKSSKLDEVGAIRVAG |
| Length | 221 |
| Position | Head |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.575 |
| Instability index | 44.13 |
| Isoelectric point | 9.25 |
| Molecular weight | 25696.42 |
| Publications | PubMed=9501997
PubMed=27862469
PubMed=17560376
PubMed=22021418
PubMed=30307032
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IDA:UniProtKB
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31303
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.21| 21| 21| 132| 152| 1
---------------------------------------------------------------------------
132- 152 (43.77/15.93) HKDRDKDKDREHKKHKHKHKD
154- 174 (39.44/13.69) SKDKDKDKDRDRKKDKNGHHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.97| 21| 21| 64| 84| 2
---------------------------------------------------------------------------
64- 84 (34.40/25.16) QLDQLIESISQSRETNIRIQP
86- 106 (35.57/26.23) DIDELQESFQLNDMTPVELPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.77| 12| 21| 178| 190| 3
---------------------------------------------------------------------------
178- 190 (19.11/10.62) HSKKHHdKKRKHD
201- 212 (21.66/ 7.95) HKKNKH.KSSKLD
---------------------------------------------------------------------------
|