<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31301
| Description |
Probable mediator of RNA polymerase II transcription subunit 15b |
| Sequence | MIILLFFVDQIHQRDLNEIYQRVAAKLQQEDSLSHQKQRSDQFEKLKRGKTVLEGMLRFLSLSKSNIKPDLKDSMDYRKNNIMNFLNMQSLRKTVQKLQLTKSEIQPMQQPLSQTVQDQSHDDQTTLQMQSMSMQGAGSRVQQIRQGVLQSLEIGTPGISASPLLPELTSPDGNIINPLTSTCGKSSATELPIERLIRAMKSISPQALSSAVCDIRSVVSMVDRIAGSVPGKGSRASFGVDLVAMTKCHLQERNFMTQDGDHEKEASDNPNAIKCCFIGRKALVIATSILLVW |
| Length | 293 |
| Position | Tail |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.335 |
| Instability index | 51.02 |
| Isoelectric point | 9.08 |
| Molecular weight | 32657.31 |
| Publications | PubMed=11130712
PubMed=27862469
PubMed=22021418
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors (By similarity).
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31301
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.48| 17| 51| 89| 105| 1
---------------------------------------------------------------------------
89- 105 (26.36/15.49) QSL..RKTV.Q....KLQLTKSEI
119- 141 (17.24/ 7.91) QSHddQTTL.QmqsmSMQGAGSRV
142- 159 (22.88/12.60) QQI..RQGVlQ....SLEIGTPGI
---------------------------------------------------------------------------
|