Description | Isoform 2 of Mediator of RNA polymerase II transcription subunit 10b |
Sequence | MDPTQNTSAGIGGSNGTIRYQTNDGTSTVTVADDSKENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQIPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQNFPDEVDMYREIRASSAAVTKRLAQSQSVLPNGDAKVKNEL |
Length | 189 |
Position | Middle |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.492 |
Instability index | 28.52 |
Isoelectric point | 5.23 |
Molecular weight | 20912.31 |
Publications | PubMed=11130712 PubMed=27862469 PubMed=14593172 PubMed=17560376 PubMed=22021418 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors.
|
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IDA:UniProtKB |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31294 No repeats found |
MoRF Sequence | Start | Stop |
1) MYREIRA 2) SAGIGGSNGTIRYQT | 156 8 | 162 22 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab