<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31290
| Description |
"Crooked legs, isoform H" |
| Sequence | MQHVSAASSVPSVVTPVVTTGGTTITLGGPPPLPKSEHKEDGKPPHGIEMYKVNIEDISQLFTYHEVFGKIHGDVVNHQLAAAHGGQLPPPPPLPPQVTSHAASAAAAAAAASTNNAAVAAVMASANAAAAAAAAASAGGGLPPATSGNGGQQVTVTTTSSSTSSGGSTTSGGTTTTAGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKVPHHSATTTMHTIQQITAGAAGGAGAVQLTPGLVPLVTSTLISHNAAAQQQSQKQQAAAAAAAQQQAAAAAAAQQQAAQQQAAAAHQQHQQQVAAQHQQQAAVAAHQQQQQQLQQQQQLLQLSIQQAAHHHQQEQHRQQQQQQHQQQQQQQHHQQQQQGHPQAPPPQQQQQPPPIALISDPSALARAAIQLQHLPANVEQHPVVY |
| Length | 686 |
| Position | Kinase |
| Organism | Drosophila melanogaster (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.782 |
| Instability index | 52.06 |
| Isoelectric point | 9.26 |
| Molecular weight | 75058.98 |
| Publications | PubMed=10731132
PubMed=12537568
PubMed=12537572
PubMed=12537573
PubMed=12537574
PubMed=16110336
PubMed=17569856
PubMed=17569867
|
Function
| Annotated function |
|
| GO - Cellular Component | heterochromatin GO:0000792 IDA:FlyBase
nucleus GO:0005634 IDA:FlyBase
|
| GO - Biological Function | DNA-binding transcription factor activity, RNA polymerase II-specific GO:0000981 IBA:GO_Central
RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IBA:GO_Central
|
| GO - Biological Process | cell adhesion GO:0007155 IMFlyBase
heterochromatin organization involved in chromatin silencing GO:0070868 IMFlyBase
imaginal disc-derived wing morphogenesis GO:0007476 IMFlyBase
negative regulation of transcription, DNA-templated GO:0045892 IMFlyBase
negative regulation of Wnt signaling pathway GO:0030178 IGI:FlyBase
positive regulation of mitotic cell cycle GO:0045931 IMFlyBase
regulation of chromatin silencing GO:0031935 IMFlyBase
regulation of transcription by RNA polymerase II GO:0006357 IMFlyBase
|
Interaction
Repeat regions
| Repeats |
>MDP31290
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
11| 547.31| 24| 26| 258| 281| 1
---------------------------------------------------------------------------
179- 196 (30.57/11.07) ........G...QTPHQCDVCGKKYTRKE
201- 224 (51.59/23.07) HM.RSHT.N...ETPFRCEICGKSFSRKE
229- 253 (49.88/22.10) HI.LWHTaG...ETPHRCDFCSKTFTRKE
258- 281 (59.02/27.32) HV.RQHT.G...ESPHRCSYCMKTFTRKE
286- 309 (54.17/24.55) HI.RQHT.G...ETPFKCTYCTKAFTRKD
314- 337 (58.69/27.13) HV.RQHT.G...ESPHKCTYCTKTFTRKE
342- 365 (58.28/26.90) HV.RQHT.G...DSPHRCSYCKKTFTRKE
370- 393 (56.62/25.95) HV.RLHT.G...DSPHKCEYCQKTFTRKE
398- 421 (51.11/22.80) HM.RQHS.S...DNPHCCNVCNKPFTRKE
426- 450 (45.18/19.42) HMsRCHT.G...DRPFTCETCGKSFPLKG
455- 481 (32.20/12.00) HQ.RSHTkGqemERPFACEKCPKNFICK.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 139.98| 21| 22| 553| 573| 2
---------------------------------------------------------------------------
546- 570 (36.86/10.72) QQAaaaaAAQQQAAQ...QQAAAAHQ..QH
571- 590 (34.05/ 9.37) QQQ...vAAQHQ..Q...QAAVAAHQ..QQ
591- 617 (29.63/ 7.25) QQQ...lQQQQQLLQlsiQQAAHHHQqeQH
621- 637 (39.43/11.95) QQQ....QHQQQ.QQ...QQ...HHQ..QQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.83| 16| 22| 98| 113| 3
---------------------------------------------------------------------------
98- 113 (27.59/10.10) VTSHAASAAAAAAAAS
122- 137 (26.24/ 9.31) VMASANAAAAAAAAAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.07| 13| 25| 139| 155| 5
---------------------------------------------------------------------------
139- 155 (15.07/17.76) GGGlppATSGnGGQQVT
165- 177 (25.00/11.22) SGG...STTS.GGTTTT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.65| 11| 27| 643| 653| 6
---------------------------------------------------------------------------
643- 653 (22.39/ 9.45) QAPPPQQQQQP
673- 683 (21.25/ 8.58) QHLPANVEQHP
---------------------------------------------------------------------------
|