<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31284
| Description |
Uncharacterized protein |
| Sequence | MDLLTQLDGDIDLLLKIMSSSVAFISRKAQHTPLPSSSIPLSVLGKTEAITPAEMDEAIAELVSDLIEKADSIRSIIHHLPTAQDLATDTQLQTQLDQIQSDMQRANHEYEQAVHMANELRQEVKALLQVVADTHSASRAWLVHELQP |
| Length | 148 |
| Position | Middle |
| Organism | Pseudozyma antarctica (strain T-34) (Yeast) (Candida antarctica) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Moesziomyces.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.161 |
| Instability index | 45.49 |
| Isoelectric point | 4.75 |
| Molecular weight | 16382.38 |
| Publications | PubMed=23558529
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31284
No repeats found
No repeats found
|