<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31284
Description |
Uncharacterized protein |
Sequence | MDLLTQLDGDIDLLLKIMSSSVAFISRKAQHTPLPSSSIPLSVLGKTEAITPAEMDEAIAELVSDLIEKADSIRSIIHHLPTAQDLATDTQLQTQLDQIQSDMQRANHEYEQAVHMANELRQEVKALLQVVADTHSASRAWLVHELQP |
Length | 148 |
Position | Middle |
Organism | Pseudozyma antarctica (strain T-34) (Yeast) (Candida antarctica) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Moesziomyces.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.161 |
Instability index | 45.49 |
Isoelectric point | 4.75 |
Molecular weight | 16382.38 |
Publications | PubMed=23558529
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP31284
No repeats found
No repeats found
|