Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MASSSGSKEPTTASLLLSTLGAYSDLAKHLFASIENPSQQKTRTITDTAADKSWKLRGVSDVLAALREVDELLAQRIQLAHLHAANQATIEQLQAKARRRDRDTRQAILELSNINAELAEITRLSEDELASIARAAERPVGHATLLTYAQRLAKYTSAPPGYKLPQVASTSTTVKSEPTKAEQAGGDDGDAQADEIALGPDYNQYAKKAAAYYDPAIPSMPQEMPFPSDAMMRQGILNSADILAGAPMAEQPAEDVAMDEQDELPVADFAASYSHLREQQQRQDEDEDAFDLDLN |
Length | 295 |
Position | Middle |
Organism | Pseudozyma antarctica (strain T-34) (Yeast) (Candida antarctica) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Moesziomyces. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.528 |
Instability index | 51.66 |
Isoelectric point | 4.62 |
Molecular weight | 32041.15 |
Publications | PubMed=23558529 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31275 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 106.44| 32| 55| 133| 166| 1 --------------------------------------------------------------------------- 133- 166 (47.91/35.87) ARAAERPVGhATLLTYAQRLAKYTSaPPGYKLPQ 191- 222 (58.53/34.36) AQADEIALG.PDYNQYAKKAAAYYD.PAIPSMPQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 102.64| 37| 54| 32| 72| 2 --------------------------------------------------------------------------- 32- 72 (48.47/39.70) ASIENpSQQKTRTiTDTaaDKSWKLRGVSDVLAALREV.....DEL 88- 129 (54.17/29.70) ATIEQ.LQAKARR.RDR..DTRQAILELSNINAELAEItrlseDEL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 78.52| 22| 24| 223| 244| 3 --------------------------------------------------------------------------- 223- 244 (40.00/24.84) EMPFPSDAMMRQGILNSADILA 250- 271 (38.52/23.68) EQPAEDVAMDEQDELPVADFAA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EDEDAFDLDLN 2) ELPVADFAASYSHLREQQ 3) YYDPAIP | 285 263 212 | 295 280 218 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab