<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31269
Description |
Uncharacterized protein |
Sequence | MDHHHPPPLPQQHGDHYRPLVLSPQPDHAHALQYQQPPQQQATPPPQHHHPSLASHFHLLHLVTRLGDAIATGARDQAFDALVEELTSQFARSQQLLNSISGTLSSKSVLLTWEKYSVLIILTMVILLMTVEGQMQSLEETRQLLDQRKDLIAKYKSSVEDLLKGDPTR |
Length | 169 |
Position | Middle |
Organism | Triticum urartu (Red wild einkorn) (Crithodium urartu) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.452 |
Instability index | 48.70 |
Isoelectric point | 6.33 |
Molecular weight | 19071.46 |
Publications | PubMed=23535596
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP31269
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.49| 21| 42| 2| 22| 1
---------------------------------------------------------------------------
2- 22 (45.13/19.01) DHHHPP.....PLPQQH....GDHYRPLVL
33- 62 (33.36/12.52) QYQQPPqqqatPPPQHHhpslASHFHLLHL
---------------------------------------------------------------------------
|