<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31266
Description |
Uncharacterized protein |
Sequence | MAPPSRDVGYWVNFFRGGGETILDAIEGAIDVAASEQPAALRARRDAIAERLYTALLLASSRRLRRRRGRENQGRPRQLPGKGHAHPLVLHAAAAVRAAGCWLSEAALLDLLRRLQQLEFTVHTLKVTAIGKTVGTLRKHNSKQIRHLVRLLIGGWKSIVDEWMSNGGSGDAIVDHTPQSMHPSSLEQEDRGMSSPSVDEGALFATPSTSIRLSEDNQGSRMFDGMDDAGNTRNSVQRHPGSQEPIRRPPQPVAQQYDPDQSWRQEQSAARQSRPQELANGQTREQFIAAMLAKPSNAESGRGRPQVRPKQQQGASPAQGRPQPVPSDKPAGNPDANSLRAKLDLAKNAKLELATNSKLEMTKRKLQEGYQEFDNAKKQRTVQMVDPQDIKKQGNRAWQPNAKPRNNNSSSNTNNNRNWSSK |
Length | 422 |
Position | Unknown |
Organism | Triticum urartu (Red wild einkorn) (Crithodium urartu) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.899 |
Instability index | 61.11 |
Isoelectric point | 10.34 |
Molecular weight | 46663.71 |
Publications | PubMed=23535596
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP31266
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.05| 15| 15| 303| 317| 1
---------------------------------------------------------------------------
74- 87 (28.53/11.19) GRPRQLPG.KGHAHP
303- 317 (28.59/11.23) GRPQVRPKQQQGASP
320- 334 (29.93/12.04) GRPQPVPSDKPAGNP
---------------------------------------------------------------------------
|