<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31251

Description Uncharacterized protein
SequenceMELDVGAWVGGGGAGDVEGGGGSGAAGGAQLASSPATVFRIRLKQPPASLKYKMRVPELCRNFSAVAWCGKLNAIACASETCARIPSSNSSPPFWIPIHILNPERPTECSVFNVRADSPRDFVQFIEWSPTSCPRSLLVANFHGRITIWTQPTKGPVNLVRDSSSWQCEHEWRQDLSVVTKWLSGISPYRWLPANSSTSNLKTFEEKFLTQHPQNSAGWPNMLCVCSVFSSGSVQLHWSQWPPQNSAQPRWFSTSKGLLGAGPSGIMAADAIITESGALHVAGVPLVNPSTVVVWEVMPGLGNGIQATAKINATSPLPPSLNPPSWSGFAPLAAYLFSLQDYLVSEAAQTRKQIDNEITEAASIHCCPVSNFSAYVSPEAAAQSATTTTWGSGVTSVAFDPTRGGGVITVVIVEGQYMSPYDPDEGPSITGWRVQCWESSLQPVVLHPIFGSPSSFGGQPPMQTVWSTRVNKSIAPTEDLKNPQAYVPMPTTSDERSSSECSVDRANRLSFDPYDLPNDVRQLAQIVYSAHGGEVAVAFLRGGVHIFSGPNFDQVDSYHVNVGSSIAPPAFSSSSCCLASVWHDTLKDRTILKIIRVLPPAILNVQTKLRFVGRFWWSLMAGVDWWDAVGCTQSAAEDGIVSLNSVIALLDTDFHCLPTMQQRQQHCPNLDRIKCRLLEGTNAQDVRALVLDMQARLLLDMLGKGIESALINPSTLLPEPWQASSELLSNIEPDKMTVDPALLPSIQGYVDAVLDLASHFITRLRRYASFCRTLASHAVGASSSSGNSRNMVTSPTNNSPSPSNNQGNQGGVASATGSSQMQEWVQGAIAKISNNADGAANAAPNPVSGRSSFIPISINTGTFPGTPAVRLIGDCHFLHRLCQLLLFCLLFRRRQSPRLLANAQKNPDSAMQKIQQLMNSKIEDSSSAISAVRSGLGAAKVEDGAATRGQLVLGAKGLEENPMGKSVRIGSGNAGQGYTSDEVKVLFLILVDLCRRTSGLQHPLPVSQVGTSNIIIRLHFIDGTYTVLPEVVEASLGPHMQNMPRPRGADAAGLLLRELELQPPSEEWHRRNMFGGPWSEPDDLGPLDNMPHLKIGGHINPHLSDTEEEGKTNFGIQSLWPRKRRLSERDAAFGLKTSVGLGAYLGVMGSRRDVITAVWKTGLDGEWYKCIRCLRQTCAFAQPGAPNMANEREAWWISRWTQACPMCDETEAAVVTTQFLGIGDLFGGDILQLHQHQQQLRLGSQGSHNQALLLVGVVMTKLIAAVITKDSLSSHCCIHDLSLRLVCTALYNDGDAERKYLPQFFKFTVSNPLSVRTKVKSIIWVSPFFFQVRTIKDTTYLEACIENHTKSNLYMDQVDFEPAQQWSATILEADEHPSVVKSTIRDLCKQPILIRAAGGIYNYLYQLRPSSDEPGQIKTEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTPSKDVDLRAVKIPPVIFLERPFMVNLCLTNQTEKTVGPFEVFLAPSVSGEQKTVLVNGLQKLVLPLVEAFESINFDLKSEHGSYPTWRAKDLWNYIVCCAGKEALRTFARHRDFCRRGIEHRIHTGRPVGRARLDLQGEPYSR
Length1595
PositionTail
OrganismTriticum urartu (Red wild einkorn) (Crithodium urartu)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.08
Grand average of hydropathy-0.175
Instability index47.30
Isoelectric point7.34
Molecular weight174255.27
Publications
PubMed=23535596

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblPlants

GO - Biological Function
GO - Biological Process
circadian regulation of gene expression	GO:0032922	IEA:EnsemblPlants
positive regulation of plant-type cell wall cellulose biosynthetic process	GO:2001011	IEA:EnsemblPlants
positive regulation of systemic acquired resistance	GO:1901672	IEA:EnsemblPlants
regulation of cell wall pectin metabolic process	GO:1902066	IEA:EnsemblPlants
regulation of ethylene-activated signaling pathway	GO:0010104	IEA:EnsemblPlants
regulation of jasmonic acid mediated signaling pathway	GO:2000022	IEA:EnsemblPlants
regulation of long-day photoperiodism, flowering	GO:0048586	IEA:EnsemblPlants
regulation of transcription, DNA-templated	GO:0006355	IEA:EnsemblPlants
response to osmotic stress	GO:0006970	IEA:EnsemblPlants
root development	GO:0048364	IEA:EnsemblPlants
trichome branching	GO:0010091	IEA:EnsemblPlants
trichome papilla formation	GO:1905499	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31251
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.52|      19|      21|     825|     844|       1
---------------------------------------------------------------------------
  825-  844 (27.42/18.27)	VQG..AIAKISNNAdGAANAAP
  847-  867 (30.10/15.62)	VSGrsSFIPISINT.GTFPGTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.23|      22|      22|    1398|    1419|       2
---------------------------------------------------------------------------
 1398- 1419 (40.68/27.00)	GGIYNYLYQL..RPSSDEPGQIKT
 1421- 1444 (33.55/20.84)	GSSILGKFQItwRTNLGEPGRLQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.24|      13|     115|     759|     771|       3
---------------------------------------------------------------------------
  759-  771 (26.22/18.71)	HFITRLRRYASFC
  876-  888 (27.02/19.53)	HFLHRLCQLLLFC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.98|      15|      22|    1102|    1116|       4
---------------------------------------------------------------------------
 1102- 1116 (26.92/17.53)	HLSDTEEE.G.KTNFGI
 1125- 1141 (16.05/ 7.40)	RLSERDAAfGlKTSVGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.24|      18|     115|     109|     130|       8
---------------------------------------------------------------------------
  109-  130 (31.14/29.60)	CSVFNvradSPRDFVQFIEWSP
  226-  243 (38.10/24.72)	CSVFS....SGSVQLHWSQWPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.38|      15|      27|    1480|    1494|       9
---------------------------------------------------------------------------
 1480- 1494 (27.26/18.60)	LTNQTEKTVGPF.EVF
 1507- 1522 (21.12/12.61)	LVNGLQKLVLPLvEAF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.81|      10|      27|    1167|    1178|      10
---------------------------------------------------------------------------
 1167- 1178 (17.75/17.17)	WYkcIRCLRQTC
 1195- 1204 (24.06/14.16)	WW..ISRWTQAC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      59.19|      12|      30|     780|     791|      11
---------------------------------------------------------------------------
  780-  791 (21.04/12.06)	GASSSSGNSRNM
  797-  808 (20.52/11.53)	NNSPSPSNNQGN
  811-  821 (17.63/ 8.57)	GVASATGSSQ.M
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.68|      32|      32|     908|     939|      12
---------------------------------------------------------------------------
  908-  939 (51.29/30.78)	DSAMQKIQQLMNSKIEDSSSAISAVRSGLGAA
  943-  974 (53.40/32.35)	DGAATRGQLVLGAKGLEENPMGKSVRIGSGNA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.60|      13|      26|    1033|    1045|      16
---------------------------------------------------------------------------
 1033- 1045 (24.77/14.85)	EASLGPHMQNMPR
 1058- 1070 (24.83/14.90)	ELELQPPSEEWHR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      30.34|      11|      28|    1339|    1351|      17
---------------------------------------------------------------------------
 1339- 1351 (15.87/20.71)	TYLEAciENH...TKS
 1369- 1382 (14.47/ 8.15)	TILEA..DEHpsvVKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.95|      17|     575|     992|    1010|      19
---------------------------------------------------------------------------
  992- 1010 (28.91/25.01)	DLCRRtsGLQHPLPVSQ.VG
 1565- 1582 (30.04/18.67)	DFCRR..GIEHRIHTGRpVG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31251 with Med16 domain of Kingdom Viridiplantae
Unable to open file!