<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31248
| Description |
Uncharacterized protein |
| Sequence | MDATVDELSAAYKEFVAAAVAVMEAREQSGGQKTAATDAALEAFKQRWELFRVSCDHAEELVESIRQRIGSECLVDEATGSSSSASTPASVALAAPGIKPISAVRLEQMSKAVRWLVIELQHGVGGPSAAGPGGGVSTPAAGAGGQHVHGGGGSRFPEDGTQ |
| Length | 162 |
| Position | Tail |
| Organism | Triticum urartu (Red wild einkorn) (Crithodium urartu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.125 |
| Instability index | 55.36 |
| Isoelectric point | 5.04 |
| Molecular weight | 16517.18 |
| Publications | PubMed=23535596
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31248
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.95| 16| 17| 123| 139| 1
---------------------------------------------------------------------------
123- 139 (27.14/14.45) GVGGPSAAGpGGGVSTP
142- 157 (33.80/14.23) GAGGQHVHG.GGGSRFP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.43| 15| 17| 9| 25| 2
---------------------------------------------------------------------------
1- 22 (13.44/11.38) MDAtvdelSAAYKefVAAAVAV
23- 40 (20.99/10.42) MEA..reqSGGQK..TAATDAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.84| 14| 18| 42| 58| 3
---------------------------------------------------------------------------
42- 58 (21.33/23.88) EAFKQRwelFRVSC..DHA
63- 78 (20.51/12.50) ESIRQR...IGSEClvDEA
---------------------------------------------------------------------------
|