<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31246
| Description |
Uncharacterized protein |
| Sequence | MDSDDKKFGKGPRELTGAVDLISQYKLEPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPPHIKPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKDKDKDKDRKKDKHHEKKRKHEGTEDSADVHKHKKSKVIYNYYLLPDIMNGSLFEGASDERLACC |
| Length | 217 |
| Position | Head |
| Organism | Triticum urartu (Red wild einkorn) (Crithodium urartu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.364 |
| Instability index | 33.30 |
| Isoelectric point | 9.13 |
| Molecular weight | 25189.25 |
| Publications | PubMed=23535596
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31246
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 85.46| 17| 17| 129| 145| 1
---------------------------------------------------------------------------
129- 145 (32.61/11.31) HK.KHKDKDKDREHKKHK
148- 165 (26.37/ 7.99) HKdRSKDKDKDKDRKKDK
166- 182 (26.47/ 8.04) HH.EKKRKHEGTEDSADV
---------------------------------------------------------------------------
|