| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDSTAPNFSSAAAVAAAAAAASGNGLPGGAGRDRPADPPAAASGNGLQGGAGGDRPEDPSKQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKVLNALKGYGGGACQ |
| Length | 175 |
| Position | Middle |
| Organism | Triticum urartu (Red wild einkorn) (Crithodium urartu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.215 |
| Instability index | 26.96 |
| Isoelectric point | 5.29 |
| Molecular weight | 17742.68 |
| Publications | PubMed=23535596 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP31240
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.34| 18| 18| 21| 38| 1
---------------------------------------------------------------------------
21- 38 (39.77/19.61) ASGNGLPGGAGRDRPADP
42- 59 (39.57/19.48) ASGNGLQGGAGGDRPEDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.31| 13| 18| 70| 85| 2
---------------------------------------------------------------------------
70- 82 (22.36/16.75) SIQKTLGLLHQLN
89- 101 (21.95/ 8.19) SSASQLPLLQRLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.46| 15| 20| 127| 144| 3
---------------------------------------------------------------------------
127- 144 (19.02/23.14) NLIDDGKNpDEFtrDVLN
150- 164 (27.44/17.30) NQITKGKT.DAF..KVLN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) APNFSSAAAVAAAAAAA 2) GAGRDRPADP | 5 29 | 21 38 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab