<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31224
Description |
Uncharacterized protein |
Sequence | MQWMHMQQTKAQQPHAQQPPMASADSTAQTGYASTGDWQEEIHQMIKRLKDQYFAELSELFNKMCVKLQHVDSIIPPQISSEQYDRMKSFKTMLERILQMLQIGKSSVQPAMRDKVPRYEKQIISILNSQRKPVQPQIQQQFQPPPGQAPNSSISQQLQPSQNLQ |
Length | 165 |
Position | Tail |
Organism | Triticum urartu (Red wild einkorn) (Crithodium urartu) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.825 |
Instability index | 68.99 |
Isoelectric point | 9.27 |
Molecular weight | 19076.63 |
Publications | PubMed=23535596
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP31224
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.21| 23| 24| 95| 117| 1
---------------------------------------------------------------------------
95- 117 (38.76/15.93) ERILQMLQIGKSSVQPAMRDKV.P
121- 144 (35.45/14.11) KQIISILNSQRKPVQPQIQQQFqP
---------------------------------------------------------------------------
|