<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31210
| Description |
Uncharacterized protein |
| Sequence | MAATGGRAGGRGWGWARSGRHWIEAETPDFRARMRRIYLNNSSAISASADVAFRHALNALPEPRSIEAMARAWDASVRKAVMWFARQQGGGTISSMFGGWKRCAAA |
| Length | 106 |
| Position | Tail |
| Organism | Triticum urartu (Red wild einkorn) (Crithodium urartu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.352 |
| Instability index | 54.07 |
| Isoelectric point | 11.61 |
| Molecular weight | 11582.03 |
| Publications | PubMed=23535596
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31210
No repeats found
|