<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31195

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMQGRAILRGSACDFAPTAPLQSAEYSNPVSTAKIESINHRKVEEGAAVGVPQGGGALVGEQGRDTMPGVIMDSASRNGSHTNHDRDRQFNGPNGEAKASEKGRDKSQARSEPQQSMTPISPAVRNGMNGNSTDGPAHQQNSGEEPIPKDILDRIHDLPPEVEHITSNFLPLTELLNRLAQATHNDLRQEIMKLANMPIPQSAMNTNPPHITKEDDTSNDNVNKKVSLLNFAQTQHSRWVKQLVLLNWSRNAEEVSKIIDLNIHLCQKRGLYQYILHHMSEVKRKLCDVDSPRPDLKTAVEVLSTGKANWMPDLGYIAPPPMTPKEILKSLEKLNTLLSIRLNLHEYDKIPLQFKNYTIKSGRVTFKVAGEFEIDLTVADENQELQFWFIDFRFLFSPSLSELPPRHQYHIENKVNAALEKDGLSGCYNYLHEMVLTHKISEFRRQAVELSRSTWIDGVKVEPLHRALCIQYWLDRYKKNGPRSWIILGVHSGRRKDGYHDPKSTSRLSIRWFRDSKEVKDVDIPFDTVNISAEQLLKTVIAMHVNHILGSTHSKLAAESIFANREASLSLHTSKTEPKESVLGVQLTEKQHVSITIEPVTGIFIFSPASRIITSSQNKLNSLDRDPAMDAHFNIENLRCLAISEELTILGTSVGWRRADNPGISREDLKRKIPKDTKQISWFRRPGWQEDWLVAVTLGMSGENWWLFQMYVSSRAYNLHTNMDRSKQSTGVKVLASIHIPIKAASPTTSYVFMSTLHIFAGGLISQYTNLKALHDRRIRHTVRQSALLSPVKLPSIWIHIPGLFQARAKPTAHKTWATDFLKLDFQGLEPISNPLSVLSQSPIDDSQAIVPKPEQKTILVTVARMAVPIPALAVLNEKIDQDIAFQSKTGEIAFRLRSQVGESIIPALTERLFQIERLISCTAVLRKHENVIKCDRISLQEIAFSYGMPPVAQTGLVTSADKTTPLSYKAVVSLGLVEGKMKLTLEMGNPHIRVLDSLDKVLNIAKSGFDAVATLLPQTLYSLRAFETIENAWASLYDKGEVFVFVRAFEWFRLRYVFKPSTPNTPPRTVSFEIKMCHRKQKPWWLVRRTEKIDKSIRGDAVPDDEIDLRLKSVWDSRGDDDWKGMRTSAVGRNRGIETCLEKIDAVMRDLSPEDLAVQPSQQSQTNTQVQAVGPQGQQPSQSQQQRQLQLSTPTNSQNHPQSQGSSQGQQRMPTPNMNMNLNMNQNMNQNMNQNMLKRKSSGQAINPRAVKREVVEID
Length1259
PositionTail
OrganismBotryotinia fuckeliana (strain BcDW1) (Noble rot fungus) (Botrytis cinerea)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Sclerotiniaceae> Botrytis.
Aromaticity0.06
Grand average of hydropathy-0.469
Instability index51.61
Isoelectric point9.15
Molecular weight141850.16
Publications
PubMed=23704180

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31195
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.40|      19|      21|    1175|    1194|       1
---------------------------------------------------------------------------
 1176- 1194 (35.70/22.78)	QGQQPSQSQ..QQRQLQLSTP
 1196- 1216 (31.70/13.94)	NSQNHPQSQgsSQGQQRMPTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     313.73|      94|     169|     449|     544|       2
---------------------------------------------------------------------------
  449-  500 (71.33/51.31)	..........................................................................................................................L.....SRSTW.IDG.VK.....V.EPLHRALCI..QYWLDrYKKNGPR.SWII...LGVHSG.RRKD....GYHD
  501-  544 (42.34/28.80)	PKSTSRLSIRW.FRDSKEVKDVDIPFdTVNISAEQLLKTVIAMHV.........................................................................................................................................................
  622-  667 (26.26/11.26)	.............................................nhilgsthsklaaesifanreaslslhtsktepkesvlgvqltekqhvsitiepvtgififspasriitssqnklnsL.....DRDPA.MDAhFN.....I.ENL.RCLAI..SEEL..T..........I...LGTSVGwRRADnpgiSRED
  673-  769 (117.32/82.60)	PKDTKQIS..W.FRRPGWQEDWLVAV.TLGMSGENWW..LFQMYV...................................................................ssraynlhtnM.....DRSKQ.STG.VK.....VlASIHIPI...........KAASPTtSYVFmstLHIFAG.GLIS....QYTN
  770-  844 (56.47/34.82)	LKALHDRRIRHtVRQSALLSPVKLP..SIWIHIPGLFQA....................................................................................rakptAHKTWaTDF.LKldfqgL.EPISNPLSVlsQSPID...................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.08|      25|      30|     155|     184|       4
---------------------------------------------------------------------------
  158-  183 (41.29/39.02)	PPEV..EHITS..NFLPLTELLNrLAQATH
  207-  235 (36.80/15.00)	PPHItkEDDTSndNVNKKVSLLN.FAQTQH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.27|      12|      21|      74|      85|       5
---------------------------------------------------------------------------
   74-   85 (22.71/14.48)	ASRNGSHTNHDR
   98-  109 (18.56/10.39)	ASEKGRDKSQAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.43|      10|      22|     293|     302|      10
---------------------------------------------------------------------------
  293-  302 (16.43/ 7.43)	PDLKTAVEVL
  318-  327 (20.00/10.56)	PPPMTPKEIL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31195 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AILRGSACDFAPTAPLQSAEYSNPVSTAKIESINHRKVEEGAAVGVPQGGGALVGEQGRDTMPGVIMDSASRNGSHTNHDRDRQFNGPNGEAKASEKGRDKSQARSEPQQSMTPISPAVRNGMNGNSTDGPAHQQNSGEEPIPKDILDRIHDLPP
2) DLRQEIMKLANMPIPQSAMNTNPPHITKEDDTSND
3) MRDLSPEDLAVQPSQQSQTNTQVQAVGPQGQQPSQSQQQRQLQLSTPTNSQNHPQSQGSSQGQQRMPTPNMNMNLNMNQNMNQNMNQNMLKRKSSGQAINPRAVKREVVEID
5
185
1148
159
219
1259










Molecular Recognition Features






MoRF SequenceStartStop




NANANA