<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31191
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MSTLPSNHPLSLRPAPNTSSTSIPLPQLIARINAERGGFRNISEDSLRLEIAEAEAGGNEEENESSSEDGEAEEEPDRLKELLTARDEILGQIEHAHNAAMISLDFISLLLSKDAPVQASTSISPSLRELAGMGTLGADKTVASRYTKEQNQENKKIAKGWKASNLSKTVDSILASATRLEKEIDAETKYWEQVLAVSESGWAVCRLPQEKHTLGVRFGFSEASPTFRNRSLGALRRNPDGSIYLDQGIASPEPQSIRVLIETNGVTTGETILPKAVPHDAPIQDLILQARNTIFASELWQEMTREVRTLASHGLQSDSKTNTIRFPISPTKRILIELQAVPTDPFRPVLGPRPDSYLANGIYLTLHLLLSLSHRQQYRIRTRPPPPISSQPRPNNPFPILRSLVTRLAHETVVSSLHSLLTPLCKTLTSASLPTPPTYTISPGTSPPLLHLSTPERILTALTNQLEFFTTITFPFPLSSPPHSSIPSSFSHTTPLTPLPSSLQIRTVTTTLNYSRPIYYLRITPETSPLLQICPPPNTVPEWDYVKNYILWTVSCWLAHIFSSSSKTSEDKEEPWKPTTQPNILRKTFSGESPNEGGVKQICFDVSSIPILGPEAPTKIGEKEKEKIKISVRWEWTTGMEQEWKDKKDLKSGEGVYDWYYGGGGDGIAELQGGELEKMVRKMGDVVEEAGRGRSRS |
| Length | 697 |
| Position | Head |
| Organism | Botryotinia fuckeliana (strain BcDW1) (Noble rot fungus) (Botrytis cinerea) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Sclerotiniaceae> Botrytis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.437 |
| Instability index | 60.73 |
| Isoelectric point | 6.13 |
| Molecular weight | 77135.43 |
| Publications | PubMed=23704180
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31191
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
6| 229.63| 37| 38| 364| 400| 1
---------------------------------------------------------------------------
310- 333 (28.92/11.23) ..............................L...........AS.....HGLQ..........SDSKTNTIRF........PISPTKR
342- 393 (54.33/28.32) PTDPFrP........VlgprpdsylangiyL...........TL.....HLLL..........SLSHRQQYRIRTRP..PPPISSQPR
394- 454 (38.70/17.81) PNNPF.P........I...........lrsLvtrlahetvvsSL.....HSLLtplcktltsaSLPTPPTYTISPGT..SPPLLHLST
455- 483 (43.62/21.11) PERIL.T........A..............L...........TN.....QL..................EFFTTITF..PFPLSSPPH
495- 535 (32.00/13.30) PLTPL.P.........................sslqirtvttTL.....N..............YS.RPIYYLRITPetSPLLQICP.
536- 582 (32.06/13.34) PPNTV.PewdyvknyI.............lW...........TVscwlaHIFS..........SSSKTSED..KEEP..WKP.TTQP.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.91| 15| 98| 13| 28| 2
---------------------------------------------------------------------------
13- 28 (24.97/21.16) RPAPNTSSTSIPlPQL
113- 127 (26.94/17.29) KDAPVQASTSIS.PSL
---------------------------------------------------------------------------
|