Description | Putative mediator of rna polymerase ii transcription subunit 5 protein |
Sequence | MDAIADVFLRPQPSNHESLDPRIPRYIQVLSQRKLIDTPSILKALYKYSTSHTQAQRAGHPPLEDAQAKAITLRWGSSYASEEVIFYRLTKAVGLGTGIKSASDALDVCKIIARWMSLFSSASAAFAQDVMGQLQSTQSRDEMEAARAAFVMLLLSVCENQTVLAALSRPFAKEARKALSESLAVFVPSILQSASIAGRLELFRTETLAAFDPIDKKKDAANTEMDDILDSTVGLDGFVVTELPISNTRAGLYIYLNAAVGKQV |
Length | 264 |
Position | Tail |
Organism | Eutypa lata (strain UCR-EL1) (Grapevine dieback disease fungus) (Eutypa armeniacae) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Diatrypaceae> Eutypa. |
Aromaticity | 0.07 |
Grand average of hydropathy | 0.011 |
Instability index | 42.13 |
Isoelectric point | 6.33 |
Molecular weight | 28786.65 |
Publications | PubMed=23723393 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31182 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 82.26| 20| 21| 107| 126| 1 --------------------------------------------------------------------------- 71- 86 (20.29/10.89) ....ITLRWGS..SYASEEVIF 107- 126 (35.46/23.80) DVCKIIARWMS..LFSSASAAF 129- 150 (26.51/16.18) DVMGQLQSTQSrdEMEAARAAF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ILKALY 2) PRIPRYI | 41 21 | 46 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab