<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31182
| Description |
Putative mediator of rna polymerase ii transcription subunit 5 protein |
| Sequence | MDAIADVFLRPQPSNHESLDPRIPRYIQVLSQRKLIDTPSILKALYKYSTSHTQAQRAGHPPLEDAQAKAITLRWGSSYASEEVIFYRLTKAVGLGTGIKSASDALDVCKIIARWMSLFSSASAAFAQDVMGQLQSTQSRDEMEAARAAFVMLLLSVCENQTVLAALSRPFAKEARKALSESLAVFVPSILQSASIAGRLELFRTETLAAFDPIDKKKDAANTEMDDILDSTVGLDGFVVTELPISNTRAGLYIYLNAAVGKQV |
| Length | 264 |
| Position | Tail |
| Organism | Eutypa lata (strain UCR-EL1) (Grapevine dieback disease fungus) (Eutypa armeniacae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Xylariomycetidae> Xylariales> Diatrypaceae> Eutypa.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.011 |
| Instability index | 42.13 |
| Isoelectric point | 6.33 |
| Molecular weight | 28786.65 |
| Publications | PubMed=23723393
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31182
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 82.26| 20| 21| 107| 126| 1
---------------------------------------------------------------------------
71- 86 (20.29/10.89) ....ITLRWGS..SYASEEVIF
107- 126 (35.46/23.80) DVCKIIARWMS..LFSSASAAF
129- 150 (26.51/16.18) DVMGQLQSTQSrdEMEAARAAF
---------------------------------------------------------------------------
|