Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MHPFLSITFAGVTCRESLQASADILQQNLRSLLDILAQHNDLFNRVAVHPSTNFPGRTQEHILVQLLRKKPEPDVAAAMDEGRETLAKLVSSSLPPTTNTTTTTGQDQNRNRTSTNNNNKEPPSAEMTAEQQRKQTAELEKTWKAAREFCRARIVQYAQEEDDDPYTEEERDVIGIANVRTGLRKPQWDPFVEENEEDEDNDVMVVDRPPPPPAPAVAAPEVEGSSLENIMRFSARGEFMPSL |
Length | 243 |
Position | Head |
Organism | Eutypa lata (strain UCR-EL1) (Grapevine dieback disease fungus) (Eutypa armeniacae) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Diatrypaceae> Eutypa. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.760 |
Instability index | 57.43 |
Isoelectric point | 4.79 |
Molecular weight | 27263.97 |
Publications | PubMed=23723393 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31177 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.98| 15| 24| 95| 115| 1 --------------------------------------------------------------------------- 95- 113 (22.61/23.84) PPTTNTTTttgqDQNRNRT 122- 136 (27.37/11.09) PPSAEMTA....EQQRKQT --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) IVQYAQEEDDDPYTEEERDVIGIANVRTGLRKPQWDPFVEENEEDEDNDVMVVDRPPPPPAPAVAAPEVEGSSLENIM 2) RTQEHILVQLLRKKPEPDVAAAMDEGRETLAKLVSSSLPPTTNTTTTTGQDQNRNRTSTNNNNKEPPSAEMTAEQQRKQTAELEKT | 154 57 | 231 142 |
MoRF Sequence | Start | Stop |
1) AVAAPEVE 2) LENIMRFSAR 3) NDVMVVDR | 216 227 201 | 223 236 208 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab