<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31175
| Description |
Mediator of RNA polymerase II transcription subunit 13 |
| Sequence | MTVQETNFVVFFVYSPDISGSIVESCVAFHQLFEGYKKLLARRKGKSIVTPLADVAHEIWETTRDLVSAWKVHWRIIITKCGAIEQHEIDIWSALAQAESKAAMSLTLLAVDTDPSLQLIPPAAKIPTSSTSAFYTTPVSTPQPSMVSPEQSAPTPGSGSGGLDNVTANSAATNPGNTVPEPSDADSTLTDVTDHTWGAVLAHRLSINPQAAAADFGQTALISGYLVKRGGARVDDPPALIEVNVVYVHQHGSNGSGGGTAKENTGNPNSNNSGTASSAAYPQTHHGQSSAQSSPVAHAPPPHLHHPRAYEPLLREVLVQYRALGSLARARGVTDREVDARPWHVAAAEKGVRALYLLM |
| Length | 359 |
| Position | Kinase |
| Organism | Eutypa lata (strain UCR-EL1) (Grapevine dieback disease fungus) (Eutypa armeniacae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Xylariomycetidae> Xylariales> Diatrypaceae> Eutypa.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.203 |
| Instability index | 31.99 |
| Isoelectric point | 6.19 |
| Molecular weight | 38110.21 |
| Publications | PubMed=23723393
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31175
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 107.58| 25| 25| 143| 167| 1
---------------------------------------------------------------------------
119- 141 (25.72/12.25) ...LIPPAAKIPTSSTSAFYTTPVsT
143- 167 (41.79/24.70) QPSMVSPEQSAPTPGSGSGGLDNV.T
169- 193 (40.08/23.38) NSAATNPGNTVPEPSDADSTLTDV.T
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.09| 21| 26| 30| 50| 3
---------------------------------------------------------------------------
30- 50 (34.91/26.92) HQLFEGYKKLLARRKG..KSIVT
57- 79 (32.17/24.28) HEIWETTRDLVSAWKVhwRIIIT
---------------------------------------------------------------------------
|