<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31175

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMTVQETNFVVFFVYSPDISGSIVESCVAFHQLFEGYKKLLARRKGKSIVTPLADVAHEIWETTRDLVSAWKVHWRIIITKCGAIEQHEIDIWSALAQAESKAAMSLTLLAVDTDPSLQLIPPAAKIPTSSTSAFYTTPVSTPQPSMVSPEQSAPTPGSGSGGLDNVTANSAATNPGNTVPEPSDADSTLTDVTDHTWGAVLAHRLSINPQAAAADFGQTALISGYLVKRGGARVDDPPALIEVNVVYVHQHGSNGSGGGTAKENTGNPNSNNSGTASSAAYPQTHHGQSSAQSSPVAHAPPPHLHHPRAYEPLLREVLVQYRALGSLARARGVTDREVDARPWHVAAAEKGVRALYLLM
Length359
PositionKinase
OrganismEutypa lata (strain UCR-EL1) (Grapevine dieback disease fungus) (Eutypa armeniacae)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Diatrypaceae> Eutypa.
Aromaticity0.06
Grand average of hydropathy-0.203
Instability index31.99
Isoelectric point6.19
Molecular weight38110.21
Publications
PubMed=23723393

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
ECO:0000256	RuleBase:RU364134
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31175
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     107.58|      25|      25|     143|     167|       1
---------------------------------------------------------------------------
  119-  141 (25.72/12.25)	...LIPPAAKIPTSSTSAFYTTPVsT
  143-  167 (41.79/24.70)	QPSMVSPEQSAPTPGSGSGGLDNV.T
  169-  193 (40.08/23.38)	NSAATNPGNTVPEPSDADSTLTDV.T
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.09|      21|      26|      30|      50|       3
---------------------------------------------------------------------------
   30-   50 (34.91/26.92)	HQLFEGYKKLLARRKG..KSIVT
   57-   79 (32.17/24.28)	HEIWETTRDLVSAWKVhwRIIIT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31175 with Med13 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PALIEVNVVYVHQHGSNGSGGGTAKENTGNPNSNNSGTASSAAYPQTHHGQSSAQSSPVAHAPPPHLHHPRAYE
2) TPVSTPQPSMVSPEQSAPTPGSGSGGLDNVTANSAATNPGNTVPEPSDADSTLTDVTDH
238
137
311
195










Molecular Recognition Features






MoRF SequenceStartStop




NANANA