| Description | Putative mediator of rna polymerase ii transcription subunit 21 protein |
| Sequence | MGDRLTQLQDAVDQLAHQFVACIHYINRHHSFETLGPNDQIRDVKQEAEQQEVDPHPADVFKASQVELAQDLITKEQQIEYLISILPGLDNSEKDQERNIKELEEELKVAEAQRQEAIKEREDTLAKLDAVIRSVRRP |
| Length | 138 |
| Position | Middle |
| Organism | Eutypa lata (strain UCR-EL1) (Grapevine dieback disease fungus) (Eutypa armeniacae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Diatrypaceae> Eutypa. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.780 |
| Instability index | 55.84 |
| Isoelectric point | 4.78 |
| Molecular weight | 15935.57 |
| Publications | PubMed=23723393 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi transcription corepressor activity GO:0003714 IEA:EnsemblFungi |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats | >MDP31173 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) ASQVELAQDLITKEQQIEYLISILPGLDNSEKDQERNIKELEEELKVAEAQRQEAIKEREDTLAK 2) IRDVKQEAEQQEVDPHP | 63 41 | 127 57 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab