Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MDEQKEEIQTFHFVNYSSHSITLPSVTDDLQKMYGLSSLASRVARVDEFGNKKKMRQSYKGHIQQFPGKNVILKDRFIRDLIFGPKEEKLDKFIENLDSELIEAAFSLQPGPVPGFDSSVFGSSNTEKKNELYNEKDTMLSVSLENFKRHSKKKKRKHEDYEQSIGLEQKKYRKAN |
Length | 176 |
Position | Head |
Organism | Pneumocystis murina (strain B123) (Mouse pneumocystis pneumonia agent) (Pneumocystis carinii f. sp. muris) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Pneumocystidomycetes> Pneumocystidaceae> Pneumocystis. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.928 |
Instability index | 56.58 |
Isoelectric point | 9.06 |
Molecular weight | 20455.89 |
Publications | PubMed=26899007 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31166 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) MLSVSLENFK 2) RKHEDYEQSIGLEQKKYRK | 139 156 | 148 174 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab